Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.67
PubTator Score 5.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis -1.104 2.1e-02
adrenocortical carcinoma 1.018 2.4e-02
adult high grade glioma 1.400 3.2e-02
astrocytic glioma -1.700 1.5e-02
ependymoma -1.600 3.9e-02
oligodendroglioma -1.700 1.8e-02
osteosarcoma -1.861 1.3e-02
ovarian cancer 1.100 1.5e-03

Gene RIF (1)

AA Sequence

MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLL      1 - 70
DAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDW     71 - 140
FTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFE    141 - 210
SCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI                                      211 - 246
//

Text Mined References (8)

PMID Year Title