Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.69
PubTator Score 5.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.700 1.5e-02
ependymoma -1.600 3.9e-02
oligodendroglioma -1.700 1.8e-02
osteosarcoma -1.861 1.3e-02
adrenocortical carcinoma 1.018 2.4e-02
ulcerative colitis -1.900 5.0e-08
adult high grade glioma 1.400 3.2e-02
ovarian cancer 1.100 1.5e-03

Synonym

Accession Q9Y6H3 Q1RLM4 Q96E81
Symbols KUB3
XRCC6BP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
23670597 The data provide the first evidence for a link between the level of KUB3 amplification and expression in glioma and DSB repair efficiency.

AA Sequence

MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLL      1 - 70
DAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDW     71 - 140
FTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFE    141 - 210
SCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI                                      211 - 246
//

Text Mined References (8)

PMID Year Title
23670597 2013 Glioma-amplified sequence KUB3 influences double-strand break repair after ionizing radiation.
17135290 2007 The metalloprotease encoded by ATP23 has a dual function in processing and assembly of subunit 6 of mitochondrial ATPase.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571779 2001 KUB3 amplification and overexpression in human gliomas.
10219089 1999 Isolation of Ku70-binding proteins (KUBs).