Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.94
PubTator Score 7.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.500 2.1e-02
lung carcinoma -1.100 1.1e-06
Breast cancer 1.900 3.4e-06

Gene RIF (5)

PMID Text
26694617 Data suggest that ATP1B3 is binding partner of BST-2 and regulates stability of BST-2; ATP1B3 is co-factor that accelerates BST-2 degradation and reduces BST-2-mediated restriction of HIV-1 replication/tropism and NFkappaB activation.
24236063 B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, favoring an angiogenic phenotype.
17446412 Elevated Na+ -K+ -ATPase activity postexercise may contribute to reduced fatigue after training.
17176442 These results evidenced that the beta3 subunit of Na, K ATPase is expressed on RBC membrane but the epitope recognized by mAb P-3E10 is hidden in normal RBCs. we showed the association of beta3 subunit and alpha subunit of Na, K ATPase.
12456588 role in T and B lymphocyte activation

AA Sequence

MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVP      1 - 70
KYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPV     71 - 140
YVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMI    141 - 210
DLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA     211 - 279
//

Text Mined References (27)

PMID Year Title
26694617 2016 ATP1B3 Protein Modulates the Restriction of HIV-1 Production and Nuclear Factor ? Light Chain Enhancer of Activated B Cells (NF-?B) Activation by BST-2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24236063 2013 Identification and characterization of angiogenesis targets through proteomic profiling of endothelial cells in human cancer tissues.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20065300 2010 Expression and distribution of Na, K-ATPase isoforms in the human uterus.
19542013 2009 Reversible oxidative modification: a key mechanism of Na+-K+ pump regulation.
18522992 2008 Fast degradation of the auxiliary subunit of Na+/K+-ATPase in the plasma membrane of HeLa cells.
17446412 2007 Muscle Na+-K+-ATPase activity and isoform adaptations to intense interval exercise and training in well-trained athletes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17176442 2006 Na, K ATPase beta3 subunit (CD298): association with alpha subunit and expression on peripheral blood cells.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12558975 2003 The immunoglobulin-superfamily molecule basigin is a binding protein for oligomannosidic carbohydrates: an anti-idiotypic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456588 2002 Engagement of Na,K-ATPase beta3 subunit by a specific mAb suppresses T and B lymphocyte activation.
10636900 2000 Transport and pharmacological properties of nine different human Na, K-ATPase isozymes.
9457675 1998 Structural organization and chromosomal localization of the human Na,K-ATPase beta 3 subunit gene and pseudogene.
8798450 1996 Identification of the mammalian Na,K-ATPase 3 subunit.
6289898 1982 Mechanism of the Na+, K+ pump. Protein structure and conformations of the pure (Na+ +K+)-ATPase.
2158121 1990 Molecular genetics of Na,K-ATPase.