Property Summary

NCBI Gene PubMed Count 40
PubMed Score 19.30
PubTator Score 16.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.970 3.0e-04
glioblastoma -1.100 7.8e-04
sonic hedgehog group medulloblastoma -3.500 3.9e-10
astrocytoma 2.300 4.8e-03
atypical teratoid/rhabdoid tumor -2.300 3.4e-06
medulloblastoma, large-cell -2.800 6.1e-06
primitive neuroectodermal tumor -1.400 2.3e-03
mucosa-associated lymphoid tissue lympho... 1.197 2.7e-02
pituitary cancer 2.300 7.7e-05
psoriasis -1.100 5.4e-39

Protein-protein Interaction (9)

Gene RIF (16)

PMID Text
21196491 Retinoschisin, the protein involved in the pathogenesis of X-linked juvenile retinoschisis, membrane association is severely impaired in the absence of ATP1A3 and ATP1B2.
20937802 analysis of pathways for maturation of the Na,K-ATPase beta1 and beta2 subunits in the endoplasmic reticulum
20656459 The AMOG expression pattern with altered cellular distribution observed in malformations of cortical development suggests that AMOG might contribute to abnormal cortical development via mTOR activation.
19764716 the ER quality control system allows export only of assembled alpha-beta complexes to the Golgi, whereas the number of alpha(1) subunits in the ER determines the amount of the alpha-beta complexes
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19371356 The strong expression of AMOG within the precursor cells of gangliogliomas may represent an additional marker for the diagnostic evaluation of these glioneuronal lesions
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17683073 Observational study of gene-disease association. (HuGE Navigator)
17683073 Common genetic variation in TP53 and its flanking genes (ATP1B2) found no significant overall associations between SNPs in TP53 and breast cancer risk
17411440 Observational study of gene-disease association. (HuGE Navigator)
16865689 We identified interesting novel candidate genes that likely contribute to glioma progression and provide first evidence for a role of epigenetic silencing of AMOG in malignant glioma cells.
16430714 Observational study of gene-disease association. (HuGE Navigator)
15294280 Results demonstrated that the sodium-potassium ATPase beta2 subunit (NKA1b2) was localized both in the neuronal cytoplasm and cellular membrane.
2538450 different members of the Na,K-ATPase beta subunit family may have specialized functions.

AA Sequence

MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHT      1 - 70
PKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDN     71 - 140
GVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAEN    141 - 210
LGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR    211 - 280
VAFKLRINKT                                                                281 - 290
//

Text Mined References (43)

PMID Year Title
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
24815991 2014 Clonal heterogeneity of lymphoid malignancies correlates with poor prognosis.
23887941 2013 Na?/K?-ATPase ?2-subunit (AMOG) expression abrogates invasion of glioblastoma-derived brain tumor-initiating cells.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
21196491 2011 The Na/K-ATPase is obligatory for membrane anchorage of retinoschisin, the protein involved in the pathogenesis of X-linked juvenile retinoschisis.
20937802 2010 Diverse pathways for maturation of the Na,K-ATPase ?1 and ?2 subunits in the endoplasmic reticulum of Madin-Darby canine kidney cells.
20656459 2010 Expression patterns of AMOG in developing human cortex and malformations of cortical development.
20065300 2010 Expression and distribution of Na, K-ATPase isoforms in the human uterus.
19764716 2009 Assembly with the Na,K-ATPase alpha(1) subunit is required for export of beta(1) and beta(2) subunits from the endoplasmic reticulum.
19694409 2009 A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19683723 2009 Dysfunction of ouabain-induced cardiac contractility in mice with heart-specific ablation of Na,K-ATPase beta1-subunit.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19542013 2009 Reversible oxidative modification: a key mechanism of Na+-K+ pump regulation.
19371356 2010 Pi3K-mTOR signaling and AMOG expression in epilepsy-associated glioneuronal tumors.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17683073 2007 Common genetic variation in TP53 and its flanking genes, WDR79 and ATP1B2, and susceptibility to breast cancer.
17411440 2007 Ovarian cancer risk and common variation in the sex hormone-binding globulin gene: a population-based case-control study.
16865689 2006 Identification of novel genes associated with astrocytoma progression using suppression subtractive hybridization and real-time reverse transcription-polymerase chain reaction.
16430714 2006 Thyrotoxic periodic paralysis and polymorphisms of sodium-potassium ATPase genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294280 2004 Prokaryotic expression, polyclonal antibody preparation, and sub-cellular localization analysis of Na+, K+-ATPase beta2 subunit.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12558975 2003 The immunoglobulin-superfamily molecule basigin is a binding protein for oligomannosidic carbohydrates: an anti-idiotypic approach.
12539047 2003 Haploinsufficiency of ATP1A2 encoding the Na+/K+ pump alpha2 subunit associated with familial hemiplegic migraine type 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11193188 2001 Isoforms of Na+, K+-ATPase in human prostate; specificity of expression and apical membrane polarization.
11027149 2000 Intersubunit interactions in human X,K-ATPases: role of membrane domains M9 and M10 in the assembly process and association efficiency of human, nongastric H,K-ATPase alpha subunits (ATP1al1) with known beta subunits.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
10636900 2000 Transport and pharmacological properties of nine different human Na, K-ATPase isozymes.
9524271 1998 Structure and expression of the human Na,K-ATPase beta 2-subunit gene.
9159180 1997 Na,K-ATPase subunit isoforms in human reticulocytes: evidence from reverse transcription-PCR for the presence of alpha1, alpha3, beta2, beta3, and gamma.
8918259 1996 Expression and synthesis of the Na,K-ATPase beta 2 subunit in human retinal pigment epithelium.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8305453 1994 Nucleotide sequence of a cDNA for the beta 2 subunit isoform of Na+,K(+)-ATPase from human retina.
7711835 Subcellular distribution and immunocytochemical localization of Na,K-ATPase subunit isoforms in human skeletal muscle.
2538450 1989 Identification of a putative isoform of the Na,K-ATPase beta subunit. Primary structure and tissue-specific expression.
2158121 1990 Molecular genetics of Na,K-ATPase.
1699290 1990 Assignment of Amog (adhesion molecule on glia) gene to mouse chromosome 11 near Zfp-3 and Asgr-1,2 and to human chromosome 17.
1688561 1990 The adhesion molecule on glia (AMOG) is a homologue of the beta subunit of the Na,K-ATPase.