Property Summary

NCBI Gene PubMed Count 79
PubMed Score 23.32
PubTator Score 308.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.300 9.1e-04
astrocytoma -1.500 2.8e-12
Astrocytoma, Pilocytic -2.200 4.2e-08
atypical teratoid / rhabdoid tumor -2.400 3.0e-03
Breast cancer 2.400 3.0e-02
ductal carcinoma in situ 1.400 3.7e-02
fibroadenoma 1.400 4.8e-02
glioblastoma -2.000 3.6e-07
group 3 medulloblastoma -2.300 1.8e-05
hepatocellular carcinoma -1.100 2.9e-02
interstitial cystitis -1.100 1.3e-02
intraductal papillary-mucinous adenoma (... 1.400 2.2e-03
intraductal papillary-mucinous carcinoma... 1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.4e-03
invasive ductal carcinoma 1.500 4.7e-02
lung adenocarcinoma 1.344 3.7e-02
medulloblastoma, large-cell -2.400 1.3e-04
Multiple myeloma 2.216 2.5e-02
oligodendroglioma -1.800 2.3e-12
osteosarcoma 2.879 8.1e-05
ovarian cancer -1.900 7.4e-04
Parkinson's disease -1.200 2.7e-02
primitive neuroectodermal tumor -1.300 3.1e-02
psoriasis 1.100 4.4e-02
Waldenstrons macroglobulinemia 1.891 1.3e-02

Protein-protein Interaction (6)

Gene RIF (40)

AA Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD      1 - 70
RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFN     71 - 140
HERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP    141 - 210
VQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYG    211 - 280
ENIGYSEKDRFQGRFDVKIEVKS                                                   281 - 303
//

Text Mined References (84)

PMID Year Title