Property Summary

NCBI Gene PubMed Count 128
PubMed Score 33.10
PubTator Score 111.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.100 4.6e-03
ependymoma -1.100 2.9e-07
medulloblastoma -1.600 1.9e-04
atypical teratoid / rhabdoid tumor -1.800 3.1e-06
glioblastoma -1.200 1.5e-02
medulloblastoma, large-cell -2.600 1.3e-05
primitive neuroectodermal tumor -1.900 4.4e-05
Duchenne muscular dystrophy 1.161 1.7e-10
juvenile dermatomyositis 1.145 2.3e-09
limb girdle muscular dystrophy 2B 1.071 6.1e-05
lung cancer 1.200 2.6e-03
diabetes mellitus -1.200 9.7e-03
adult high grade glioma -1.200 1.5e-03
subependymal giant cell astrocytoma -1.372 2.1e-02
Pick disease -1.100 1.8e-03
ovarian cancer 2.100 5.6e-05

Protein-protein Interaction (9)

Gene RIF (77)

PMID Text
26446917 Our current findings demonstrate that Arctigenin is an antagonist of MR and effectively decreases the Na/K-ATPase 1 gene expression. Our work provides a hint for the drug discovery against cardiovascular disease
26418325 Mutations of the ATP1A1 depolarize adrenocortical cells, disturb the K+ sensitivity, and lower intracellular pH but do not induce an overt increase of intracellular Ca2+.
26351028 Different mutations (KCNJ5, ATP1A1, ATP2B3, and CACNA1D) are found in different aldosterone-producing nodules from the same adrenal, suggesting that somatic mutations are independent events triggered by mechanisms that remain to be identified.
26334094 Data suggest that targeting Na(+)/K(+) ATPase alpha-1 subunit (ATP1A1) is a approach to the treatment of hepatocellular carcinoma (HCC).
26285814 Mutations in ATP1A1 gene is associated with aldosterone-producing adenomas.
26158764 Gal-3 interacts with ATP1A1 and induces the phosphorylation of MDR1, mediating multidrug resistance.
25994790 Report tumor cell sensitivity to cardiac glycosides depends on pattern of expression of alpha1-, alpha2-, or alpha3-isoforms of Na-K-ATPase.
25791351 Studies indicate specific lipid-binding sites in Na,K-ATPase E1 and E2 crystal structures.
25653449 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
25631074 Cellular biotinylated ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1) protein is incorporated into HIV-1 Gag virus-like particles
25615575 Data shows that a functional 12T-insertion polymorphism in the ATP1A1 promoter confers decreased susceptibility to hypertension in a male Sardinian population supporting ATP1A1 as a hypertension susceptibility gene in this population.
25533462 The cytoplasmic domain of ATP1A1 directly interacts with FGF2 and is required for FGF2 secretion.
25416948 Cellular biotinylated ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1) protein is incorporated into HIV-1 Gag virus-like particles
25158218 Ebola VP24 protein plays a critical role in the evasion of the host immune response by interacting with human ATP1a1 protein.
25051489 Data show that the intracellular M4M5 loop of human alpha1 subunit of Na+,K+-ATPase (ATP1a1) interacts directly with rat rab GTP-binding protein Rab27a.
24819540 While JNK exerts an inhibitory effect on the ATPase, NF-kappaB increases its activity and abrogates the stimulatory effect of the sphingolipid on JNK leading thus to an additional increase in the ATPase activity.
24614174 protein kinase A and C activation can increase Na,K-ATPase activity in human muscle but not via P2Y receptor stimulation.
24503769 H-K-ATPase alpha-subunit mRNA 3' UTR to binding of miR-1289 identifies a novel regulatory mechanism of gastric acid secretion and offers new insights into mechanisms underlying transient H. pylori-induced hypochlorhydria.
24304834 JAK2 is a novel energy-sensing kinase that curtails energy consumption by downregulating Na(+)/K(+)-ATPase expression and activity.
24275648 Data indicate that overexpression of ouabain-insensitive rat Na(+)/K(+)-ATPase alpha1 failed to inhibit internalization of human Na(+)/K(+)-ATPase alpha1 expressed in the same cells.
24179102 Somatic mutations found in KCNJ5, ATP1A1, and ATP2B3 appear to be the driving forces for a higher aldosterone production and proliferations of glomerulosa cells.
24082052 ATP1A1 mutations are present in aldosterone-producing adenomas that result in an increase in CYP11B2 gene expression and may account for the dysregulated aldosterone production in a subset of patients with sporadic primary aldosteronism.
23913004 Somatic mutations in either ATP1A1 and CACNA1D were found in a subset of adrenal aldosterone-producing adenomas with a zona glomerulosa-like phenotype.
23416519 Somatic mutations in ATP1A1 gene leads to aldosterone-producing adenomas and secondary hypertension.
23349050 Evidence for a new mechanism by which hypercapnia via soluble adenylyl cyclase, cAMP, PKA Type Ialpha, and alpha-adducin regulates Na,K-ATPase endocytosis in alveolar epithelial cells.
23125841 Cellular biotinylated ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1) protein is incorporated into HIV-1 Gag virus-like particles
23048038 NRF-1 regulates Atp1a1 and Atp1b1 and are important in mediating the energy generation and neuronal activity.
22797923 ZNRF1 and ZNRF2 are new players in regulation of the ubiquitous Na(+)/K(+)ATPase that is tuned to changing demands in many physiological contexts.
22565168 Data show that Na(+),K(+)-ATPase activity was >50% lower and membrane-associated tubulin content was >200% higher in erythrocyte membranes from diabetic patients.
22269832 A significant increase in the expression of ATP1A1, which encodes the alpha1-subunit of the Na(+)/K(+)-ATPase, was identified in HNF1B patients consistent with its role in Mg(2+) homeostasis.
21498719 There was overexpression of the alpha1 or alpha3 NaK subunits in more than half of the medulloblastomas.
21449573 FXYD1 raises the affinity of the human alpha1beta1 isoform of Na,K-ATPase for Na ions
21141520 Ouabain could up-regulate Na+, K(+)-ATPase alpha1 subunit expression and reduce beta1-subunit expression which mediated signal transduction and decreased cell-cell adhesions and induced ECV304 cell death.
21043236 Studies indicate that change of Na,K-ATPase activity can influence neurotransmitter release.
20964587 The increased maternal AChE and Na(+), K(+)-ATPase activities may be due to the low total antioxidant status determined post vaginal delivery, whereas their decreased activities in prematures to their immaturity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20450619 Silencing ATP1A1 inhibits the proliferation of HepG2 cells by decreasing the expression of MAPK1 and induces cell cycle arrest.
20427472 Results suggest that the association of NHE-1 with Na-K-ATPase is critical for ouabain-mediated regulation of Na-K-ATPase and that these effects may play a role in cardioglycoside-stimulated hypertension.
20332111 These results suggest that Akt plays a major role in Na(+)/K(+)-ATPase intracellular translocation and thus in alveolar fluid reabsorption.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19865785 Data conclude that human proximal tubular cells respond to a hyperosmotic challenge with an increase in FXYD2 and Na,K-ATPase protein expression, though to a smaller absolute extent in patient cells.
19863947 brain-region specific increases in the activities of Na(+)/K(+)-ATPase and Ca(2+)/Mg(2+)-ATPase in autism
19751721 Cardiac glycosides show distinct isoform specific affinities and different affinity profiles to Na(+),K(+)-ATPase isoforms which have different subcellular localizations in human cardiomyocytes.
19638348 Data show that PLM associates with and modulates both NKA-alpha1 and NKA-alpha2 in a comparable but not identical manner.
19243476 the sodium pump alpha1 sub-unit has a role in progression of metastatic melanoma
19109419 FXYD3 silencing prevents proper regulation of Na,K-ATPase, which leads to perturbation of cellular Na+ and K+ homeostasis and changes in the expression of Na,K-ATPase isozymes, whose functional properties are incompatible with cell differentiation.
19058785 Significant nominal association with bipolar disooder was observed for single Single Nucleotide Polymorphism(rs11805078 ) in the gene of ATP1A1.
19058785 Observational study of gene-disease association. (HuGE Navigator)
18801933 HEXIM1 may participate in tissue-selective determination of glucocorticoid sensitivity via direct interaction with GR at least in certain gene sets including atp1a1 and scnn1a.
18769045 Moderate apoptotic cell shrinkage may be associated with both an increase in K(+) channel permeability and inhibition of the pump whereas more remarkable shrinkage occurs presumably due to inhibition of the pump.
18768923 Ankyrin facilitates intracellular trafficking of alpha1-Na+-K+-ATPase in polarized cells.
18348163 Data show that JNK modulates the effect of caspases and NF-kappaB in the TNF-alpha-induced down-regulation of Na+/K+ATPase in HepG2 cells.
18094063 after the 4-wk sprint training period, the expression of the muscle Na+-K+ pump alpha1-subunit and Na+/H+-exchanger isoform 1 was higher
17881356 31KKE in H1 and 47HRK in H2 of the Na,K-ATPase have distinct roles in modulating the enzyme's conformational transitions during the catalytic cycle of the enzyme
17446437 Observational study of gene-disease association. (HuGE Navigator)
17446437 study reports the association of human ATP1A1 (P<0.000005) and Dear (P<0.03) with hypertension in a relatively isolated, case/control hypertension cohort from northern Sardinia
17446412 Elevated Na+ -K+ -ATPase activity postexercise may contribute to reduced fatigue after training.
17176442 Na, K ATPase alpha subunit is associated with the Na, K ATPase beta3 subunit on the red blood cells.
16893516 Observational study of gene-disease association. (HuGE Navigator)
16723354 identified a well conserved Na,K-ATPase catalytic alpha-subunit motif that binds to the inositol 1,4,5-trisphosphate receptor and can trigger an anti-apoptotic calcium signal.
16708288 after an ischaemic insult, alpha1 and beta1 protein subunit abundance and mRNA levels are independently regulated.
16498080 Phosphorylation of AP-2 mu2 subunit is essential for Na+,K+-ATPase endocytosis in response to a variety of signals, such as dopamine or reactive oxygen species.
16430714 Observational study of gene-disease association. (HuGE Navigator)
16243970 Mice with the ouabain-sensitive "human-like" alpha1 isoform developed ACTH-induced hypertension to greater extent than WT animals
16230337 N-glycans linked to the beta2 subunit of the Na,K-ATPase contain apical sorting information, and the high abundance of the beta2 subunit isoform along with the absence of the beta1 subunit, is responsible for the unusual apical location of the Na,K-ATPase
15515123 Decreases in erythrocyte membrane Na(+)K(+) ATPase activity is associated with rheumatoid arthritis
14993422 Na+-K+--ATPase-mediated signal transduction: from protein interaction to cellular function.
14685860 In the control subjects the Na,K-pump isoform alpha1 was increased by 37% in resistance trained compared to untrained leg, and in the diabetics the alpha1 content was 45% higher in resistance trained compared to untrained leg.
14555664 At high altitude, the amount of mRNA of Na-K-ATPase, CFTR, and beta-actin of brush biopsies did not change in controls but decreased significantly in high altitude pulmonary edema-susceptible subjects
14522987 sequence 442GDASE446 in the ATP binding pocket of Na/K-ATPase is an important motif and is involved in both the high and low affinity ATP effects rather than in free Mg2+, Na+, and K+ effects
12788896 data suggest that activity is reduced in the microvillous membrane of placentas from IUGR pregnancies; changes might impair function of Na(+)-coupled transporters and contribute to reduced growth of fetuses
12671055 hypoxia decreases Na,K-ATPase activity in alveolar epithelial cells by triggering its endocytosis through mitochondrial reactive oxygen species and PKC-zeta-mediated phosphorylation of the Na,K-ATPase alpha(1) subunit
12461183 A search for potential cation binding sites involved calculation of the valence expected from the disposition of oxygen atoms in the models. This identified 3 positions for Na+ & 2 for K+ at which high affinity for the respective cation is expected.
11926353 Atp1a1 activity in VSMC and REC cells of rats, dog, and human show that Atp1a1 does not mediate the involvement of ouabain in the development of hypertension in rats, suggesting that the pathogenesis of human and rat hypertension may differ.
11887161 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11564973 Observational study of gene-disease association. (HuGE Navigator)
11509477 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE      1 - 70
ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV     71 - 140
IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG    141 - 210
CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG    211 - 280
QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR    281 - 350
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA    351 - 420
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL    421 - 490
SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL    491 - 560
PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG    561 - 630
VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI    631 - 700
IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD    701 - 770
NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK    771 - 840
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ    841 - 910
RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM    911 - 980
YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY                               981 - 1023
//

Text Mined References (136)

PMID Year Title
26446917 2016 Arctigenin antagonizes mineralocorticoid receptor to inhibit the transcription of Na/K-ATPase.
26418325 2015 Pathogenesis of Adrenal Aldosterone-Producing Adenomas Carrying Mutations of the Na(+)/K(+)-ATPase.
26351028 2015 Different Somatic Mutations in Multinodular Adrenals With Aldosterone-Producing Adenoma.
26334094 2015 Na+/K+-ATPase ?1 subunit, a novel therapeutic target for hepatocellular carcinoma.
26285814 2015 Novel somatic mutations and distinct molecular signature in aldosterone-producing adenomas.
26158764 2015 Extracellular galectin-3 programs multidrug resistance through Na+/K+-ATPase and P-glycoprotein signaling.
25994790 2015 Cardiac glycosides induced toxicity in human cells expressing ?1-, ?2-, or ?3-isoforms of Na-K-ATPase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25791351 2015 General and specific lipid-protein interactions in Na,K-ATPase.
25653449 2015 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
25615575 2015 A functional 12T-insertion polymorphism in the ATP1A1 promoter confers decreased susceptibility to hypertension in a male Sardinian population.
25533462 2015 A direct role for ATP1A1 in unconventional secretion of fibroblast growth factor 2.
25158218 2014 Elucidation of the Ebola virus VP24 cellular interactome and disruption of virus biology through targeted inhibition of host-cell protein function.
25051489 2014 A role for Na+,K+-ATPase ?1 in regulating Rab27a localisation on melanosomes.
24819540 2014 Ceramide and its metabolites modulate time-dependently the activity of the Na?/K? ATPase in HepG2 cells.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24614174 2014 Purinergic effects on Na,K-ATPase activity differ in rat and human skeletal muscle.
24503769 2014 Helicobacter pylori-induced posttranscriptional regulation of H-K-ATPase ?-subunit gene expression by miRNA.
24391932 2013 Properties and expression of Na+/K+-ATPase ?-subunit isoforms in the brain of the swamp eel, Monopterus albus, which has unusually high brain ammonia tolerance.
24304834 2014 Energy-sensitive regulation of Na+/K+-ATPase by Janus kinase 2.
24275648 2014 Ouabain-induced internalization and lysosomal degradation of the Na+/K+-ATPase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24179102 2014 Complementary somatic mutations of KCNJ5, ATP1A1, and ATP2B3 in sporadic aldosterone producing adrenal adenomas.
24082052 2014 Somatic ATP1A1, ATP2B3, and KCNJ5 mutations in aldosterone-producing adenomas.
23913004 2013 Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension.
23416519 2013 Somatic mutations in ATP1A1 and ATP2B3 lead to aldosterone-producing adenomas and secondary hypertension.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23349050 2013 Protein kinase A-I? regulates Na,K-ATPase endocytosis in alveolar epithelial cells exposed to high CO(2) concentrations.
23224879 2013 Coordinated regulation of cardiac Na(+)/Ca (2+) exchanger and Na (+)-K (+)-ATPase by phospholemman (FXYD1).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23048038 2012 Regulation of Na(+)/K(+)-ATPase by nuclear respiratory factor 1: implication in the tight coupling of neuronal activity, energy generation, and energy consumption.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22565168 2012 High glucose levels induce inhibition of Na,K-ATPase via stimulation of aldose reductase, formation of microtubules and formation of an acetylated tubulin/Na,K-ATPase complex.
22269832 2012 Expression of renal cystic genes in patients with HNF1B mutations.
22084111 2011 POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters.
21498719 2011 Immunohistochemical analyses of alpha1 and alpha3 Na+/K+-ATPase subunit expression in medulloblastomas.
21449573 2011 Phospholemman (FXYD1) raises the affinity of the human ?1?1 isoform of Na,K-ATPase for Na ions.
21278788 2011 Translationally controlled tumor protein induces human breast epithelial cell transformation through the activation of Src.
21269460 2011 Initial characterization of the human central proteome.
21141520 2008 [The role of ouabain in cell death of vascular endothelial cells ECV304 and the changes of expression of Na+, K(+)-ATPase alpha1, beta1-subunit].
21043236 1981 Does Na,K-ATPase play a role in the regulation of neurotransmitter release by prejunctional alpha-adrenoceptors?
20964587 2010 Erythrocyte membrane AChE, Na(+), K(+)-ATPase and Mg(2+) ATPase activities in mothers and their premature neonates in relation to the mode of delivery.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20450619 2010 [Effect of Na(+)/K(+)-ATPase alpha1 siRNA and ouabain upon cell cycle in human hepatoma HepG2 cell and its mechanism].
20427472 2010 Ouabain stimulates Na-K-ATPase through a sodium/hydrogen exchanger-1 (NHE-1)-dependent mechanism in human kidney proximal tubule cells.
20332111 2010 Insulin regulates alveolar epithelial function by inducing Na+/K+-ATPase translocation to the plasma membrane in a process mediated by the action of Akt.
20065300 2010 Expression and distribution of Na, K-ATPase isoforms in the human uterus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19865785 2009 FXYD2 and Na,K-ATPase expression in isolated human proximal tubular cells: disturbed upregulation on renal hypomagnesemia?
19863947 2009 Increased activities of Na+/K+-ATPase and Ca2+/Mg2+-ATPase in the frontal cortex and cerebellum of autistic individuals.
19751721 2009 Isoform specificity of cardiac glycosides binding to human Na+,K+-ATPase alpha1beta1, alpha2beta1 and alpha3beta1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19683723 2009 Dysfunction of ouabain-induced cardiac contractility in mice with heart-specific ablation of Na,K-ATPase beta1-subunit.
19638348 2009 Isoform specificity of the Na/K-ATPase association and regulation by phospholemman.
19542013 2009 Reversible oxidative modification: a key mechanism of Na+-K+ pump regulation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19243476 2009 The sodium pump alpha1 sub-unit: a disease progression-related target for metastatic melanoma treatment.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19109419 2009 A link between FXYD3 (Mat-8)-mediated Na,K-ATPase regulation and differentiation of Caco-2 intestinal epithelial cells.
19058785 2009 Association between sodium- and potassium-activated adenosine triphosphatase alpha isoforms and bipolar disorders.
18801933 2008 Tissue- and context-dependent modulation of hormonal sensitivity of glucocorticoid-responsive genes by hexamethylene bisacetamide-inducible protein 1.
18769045 2008 Pump and channel K (Rb+) fluxes in apoptosis of human lymphoid cell line U937.
18768923 2008 Ankyrin facilitates intracellular trafficking of alpha1-Na+-K+-ATPase in polarized cells.
18522992 2008 Fast degradation of the auxiliary subunit of Na+/K+-ATPase in the plasma membrane of HeLa cells.
18348163 2008 JNK modulates the effect of caspases and NF-kappaB in the TNF-alpha-induced down-regulation of Na+/K+ATPase in HepG2 cells.
18094063 2008 Reduced volume but increased training intensity elevates muscle Na+-K+ pump alpha1-subunit and NHE1 expression as well as short-term work capacity in humans.
17881356 2007 Specific sites in the cytoplasmic N terminus modulate conformational transitions of the Na,K-ATPase.
17446437 2007 Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects.
17446412 2007 Muscle Na+-K+-ATPase activity and isoform adaptations to intense interval exercise and training in well-trained athletes.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17176442 2006 Na, K ATPase beta3 subunit (CD298): association with alpha subunit and expression on peripheral blood cells.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16893516 2006 Predominance of interaction among wild-type alleles of CYP11B2 in Himalayan natives associates with high-altitude adaptation.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16730713 2006 Inhibition of Na,K-ATPase-suppressive activity of translationally controlled tumor protein by sorting nexin 6.
16723354 2006 Distinct role of the N-terminal tail of the Na,K-ATPase catalytic subunit as a signal transducer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16708288 2006 Evolution of renal function and Na+, K +-ATPase expression during ischaemia-reperfusion injury in rat kidney.
16498080 2006 Phosphorylation of adaptor protein-2 mu2 is essential for Na+,K+-ATPase endocytosis in response to either G protein-coupled receptor or reactive oxygen species.
16430714 2006 Thyrotoxic periodic paralysis and polymorphisms of sodium-potassium ATPase genes.
16243970 2005 The highly conserved cardiac glycoside binding site of Na,K-ATPase plays a role in blood pressure regulation.
16230337 2005 Recombinant addition of N-glycosylation sites to the basolateral Na,K-ATPase beta1 subunit results in its clustering in caveolae and apical sorting in HGT-1 cells.
15671290 2005 The influence of SRC-family tyrosine kinases on Na,K-ATPase activity in lens epithelium.
15515123 Serum E-selectin and erythrocyte membrane Na+K+ ATPase levels in patients with rheumatoid arthritis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383549 2004 Translationally controlled tumor protein interacts with the third cytoplasmic domain of Na,K-ATPase alpha subunit and inhibits the pump activity in HeLa cells.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
15069082 2004 ERK1/2 mediates insulin stimulation of Na(+),K(+)-ATPase by phosphorylation of the alpha-subunit in human skeletal muscle cells.
14993422 2003 Na+-K+--ATPase-mediated signal transduction: from protein interaction to cellular function.
14759258 2004 An unappreciated role for RNA surveillance.
14742675 2004 New molecular determinants controlling the accessibility of ouabain to its binding site in human Na,K-ATPase alpha isoforms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685860 2004 Effect of resistance training on Na,K pump and Na+/H+ exchange protein densities in muscle from control and patients with type 2 diabetes.
14597563 2004 Ischemia-induced phosphorylation of phospholemman directly activates rat cardiac Na/K-ATPase.
14555664 2003 Altered ion transporter expression in bronchial epithelium in mountaineers with high-altitude pulmonary edema.
14522987 2003 The amino acid sequence 442GDASE446 in Na/K-ATPase is an important motif in forming the high and low affinity ATP binding pockets.
12788896 2003 Activity and protein expression of Na+/K+ ATPase are reduced in microvillous syncytiotrophoblast plasma membranes isolated from pregnancies complicated by intrauterine growth restriction.
12671055 2003 Hypoxia-induced endocytosis of Na,K-ATPase in alveolar epithelial cells is mediated by mitochondrial reactive oxygen species and PKC-zeta.
12519789 2003 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461183 2002 Homology modeling of the cation binding sites of Na+K+-ATPase.
12093728 2002 FXYD7 is a brain-specific regulator of Na,K-ATPase alpha 1-beta isozymes.
12031509 2002 K+ cycling and the endocochlear potential.
11926353 2002 The alpha1-Na/K pump does not mediate the involvement of ouabain in the development of hypertension in rats.
11887161 2002 Genetic and environmental regulation of Na/K adenosine triphosphatase activity in diabetic patients.
11832419 2002 Distribution and oligomeric association of splice forms of Na(+)-K(+)-ATPase regulatory gamma-subunit in rat kidney.
11564973 2001 Non-association of the thiazide-sensitive Na,Cl-cotransporter gene with polygenic hypertension in both rats and humans.
11546672 2001 All human Na(+)-K(+)-ATPase alpha-subunit isoforms have a similar affinity for cardiac glycosides.
11509477 2001 Interaction of alpha(1)-Na,K-ATPase and Na,K,2Cl-cotransporter genes in human essential hypertension.
11404365 2001 Ion pumps in polarized cells: sorting and regulation of the Na+, K+- and H+, K+-ATPases.
11139403 2001 Interaction of the alpha subunit of Na,K-ATPase with cofilin.
11027149 2000 Intersubunit interactions in human X,K-ATPases: role of membrane domains M9 and M10 in the assembly process and association efficiency of human, nongastric H,K-ATPase alpha subunits (ATP1al1) with known beta subunits.
10636900 2000 Transport and pharmacological properties of nine different human Na, K-ATPase isozymes.
10516168 1999 Evidence for an interaction between adducin and Na(+)-K(+)-ATPase: relation to genetic hypertension.
10473631 1999 Insulin-induced stimulation of Na+,K(+)-ATPase activity in kidney proximal tubule cells depends on phosphorylation of the alpha-subunit at Tyr-10.
9481617 1997 Na,K-ATPase mRNA levels and plaque load in Alzheimer's disease.
9159180 1997 Na,K-ATPase subunit isoforms in human reticulocytes: evidence from reverse transcription-PCR for the presence of alpha1, alpha3, beta2, beta3, and gamma.
8918259 1996 Expression and synthesis of the Na,K-ATPase beta 2 subunit in human retinal pigment epithelium.
8833915 1996 Regional expression of sodium pump subunits isoforms and Na+-Ca++ exchanger in the human heart.
8391840 1993 Expression of alpha isoforms of the Na,K-ATPase in human heart.
8082931 1994 Confirmation of mutant alpha 1 Na,K-ATPase gene and transcript in Dahl salt-sensitive/JR rats.
7775468 1995 Structural basis for species-specific differences in the phosphorylation of Na,K-ATPase by protein kinase C.
7711835 Subcellular distribution and immunocytochemical localization of Na,K-ATPase subunit isoforms in human skeletal muscle.
7536695 1995 Characterization and quantification of full-length and truncated Na,K-ATPase alpha 1 and beta 1 RNA transcripts expressed in human retinal pigment epithelium.
3036582 1987 The family of human Na+,K+-ATPase genes. No less than five genes and/or pseudogenes related to the alpha-subunit.
3035563 1987 Multiple genes encode the human Na+,K+-ATPase catalytic subunit.
3030810 1987 The family of human Na+,K+-ATPase genes. A partial nucleotide sequence related to the alpha-subunit.
2891135 1987 Human placental Na+,K+-ATPase alpha subunit: cDNA cloning, tissue expression, DNA polymorphism, and chromosomal localization.
2887455 1987 Family of Na+,K+-ATPase genes. Intra-individual tissue-specific restriction fragment length polymorphism.
2842249 1988 Chromosomal localization of human Na+, K+-ATPase alpha- and beta-subunit genes.
2430951 1986 Primary structure of the alpha-subunit of human Na,K-ATPase deduced from cDNA sequence.
2158121 1990 Molecular genetics of Na,K-ATPase.
1975705 1990 Alteration of alpha 1 Na+,K(+)-ATPase 86Rb+ influx by a single amino acid substitution.
1970326 1990 The human Na, K-ATPase alpha 1 gene: characterization of the 5'-flanking region and identification of a restriction fragment length polymorphism.
1380674 1992 Predominant naturally processed peptides bound to HLA-DR1 are derived from MHC-related molecules and are heterogeneous in size.