Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.38
PubTator Score 7.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
oligodendroglioma 3.200 4.3e-03
osteosarcoma 1.027 4.3e-04
atypical teratoid / rhabdoid tumor 1.100 1.6e-02
pancreatic ductal adenocarcinoma liver m... -1.152 1.6e-02
non-small cell lung cancer -2.477 2.4e-25
breast carcinoma -1.400 1.2e-05
fibroadenoma -1.200 1.1e-02
Breast cancer -2.500 2.8e-02
interstitial cystitis -1.500 4.1e-04
cystic fibrosis -1.200 1.2e-04
pilocytic astrocytoma 1.200 1.0e-04
lung adenocarcinoma -3.200 4.7e-16
Endometriosis -1.231 3.7e-02
ductal carcinoma in situ -1.800 1.4e-04
invasive ductal carcinoma -2.100 1.0e-03
psoriasis -1.600 4.8e-51

Gene RIF (5)

PMID Text
26099525 ATOH8 appears to be a tumor suppressor that induces stem-cell features and chemoresistance in HCC cells.
25514850 Regeneration marker ATOH8 contributes to muscle cell differentiation in healthy and diseased human muscle tissue.
21857980 Data show that in ATOH8 was hosted in one chromosome which is a fusion product of two orthologous chromosomes in non-human. primates.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPV      1 - 70
PVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPGLPTPPPPPPPAPQSQAPGGP     71 - 140
EAQPFREPGLRPRILLCAPPARPAPSAPPAPPAPPESTVRPAPPTRPGESSYSSISHVIYNNHQDSSASP    141 - 210
RKRPGEATAASSEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYIL    211 - 280
SLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE                                 281 - 321
//

Text Mined References (15)

PMID Year Title
26099525 2015 Loss of ATOH8 Increases Stem Cell Features of Hepatocellular Carcinoma Cells.
25514850 2015 ATOH8: a novel marker in human muscle fiber regeneration.
24463812 2014 The role of Hath6, a newly identified shear-stress-responsive transcription factor, in endothelial cell differentiation and function.
24236640 2014 The transcription factor ATOH8 is regulated by erythropoietic activity and regulates HAMP transcription and cellular pSMAD1,5,8 levels.
21857980 2011 Diversification and molecular evolution of ATOH8, a gene encoding a bHLH transcription factor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419857 2002 Gene expression profile of human endothelial cells exposed to sustained fluid shear stress.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.