Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.08
PubTator Score 8.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.4e-04
Breast cancer 2.600 2.6e-02
dermatomyositis -1.100 3.0e-03
glioblastoma -1.300 2.1e-06
invasive ductal carcinoma -1.043 1.2e-02
nasopharyngeal carcinoma 1.100 5.6e-03
osteosarcoma -1.663 1.4e-06
Pick disease -1.100 1.9e-03
primary pancreatic ductal adenocarcinoma 1.052 2.0e-02
psoriasis -1.700 5.9e-05
subependymal giant cell astrocytoma -1.497 4.0e-02

Gene RIF (3)

AA Sequence

MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDD      1 - 70
HNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWR     71 - 140
GGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQ    141 - 210
EDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNV    211 - 280
RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCR    281 - 350
DLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLD    351 - 420
LKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISG    421 - 490
LTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQ    491 - 560
SVTNSIKAGLTDQVSHHARLKTD                                                   561 - 583
//

Text Mined References (24)

PMID Year Title