Property Summary

NCBI Gene PubMed Count 78
PubMed Score 119.69
PubTator Score 135.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 3A 1 0.0 5.0
Disease Target Count Z-score Confidence
Cerebral palsy 40 3.061 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.400 9.0e-08
astrocytic glioma -2.000 2.1e-03
Astrocytoma, Pilocytic -1.400 9.6e-07
atypical teratoid / rhabdoid tumor -3.500 1.3e-06
Breast cancer -1.200 4.5e-05
ependymoma -2.300 6.5e-03
glioblastoma -2.100 2.0e-09
group 4 medulloblastoma -1.700 3.8e-06
medulloblastoma, large-cell -2.600 1.0e-06
oligodendroglioma -1.500 1.4e-02
ovarian cancer -2.200 7.3e-10
primitive neuroectodermal tumor -1.500 2.7e-04
psoriasis -1.100 3.2e-91

Gene RIF (60)

AA Sequence

MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAV      1 - 70
SVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKV     71 - 140
AVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQ    141 - 210
SLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNP    211 - 280
NFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQA    281 - 350
TAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ    351 - 420
LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCT    421 - 490
WAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM      491 - 558
//

Text Mined References (85)

PMID Year Title