Property Summary

NCBI Gene PubMed Count 49
PubMed Score 787.35
PubTator Score 191.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.572 9.4e-04
astrocytoma 1.200 9.3e-03
medulloblastoma, large-cell 1.200 2.7e-03
non-small cell lung cancer 1.023 1.1e-20
lung cancer 2.500 1.2e-05
diabetes mellitus -1.300 1.4e-03
group 4 medulloblastoma -1.200 1.7e-04
ovarian cancer 1.900 3.1e-05

Protein-protein Interaction (2)

Gene RIF (34)

PMID Text
26799664 ATIC 347C>G gene polymorphism may be associated with the development of MTX induced gastrointestinal adverse events.
25823786 This study shows that polymorphisms on genes related to the metabolic pathway of pemetrexed, especially, ATIC and GGH genes, would have a therapeutic implication in pemetrexed-treated patients with lung adenocarcinoma
25687571 PTPLAD1 and AMPK are rapidly compartmentalized within the plasma membrane (PM) and Golgi/endosome fractions after insulin stimulation and that ATIC later accumulates in the Golgi/endosome fraction.
25687571 Our data show that ATIC is in complex with insulin receptor (IR)and siRNA-mediated partial knockdown of ATIC in HEK293 cells, decreases IR tyrosine phosphorylation and regulates IR endocytosis. Insulin stimulation and ATIC knockdown readily increase level of AMPK-Thr172 phosphorylation in IR complexes.ATIC depletion delayed insulin response of Glut2 translocation in HEK293 cells and decreased AKT-Ser473 phosphorylation.
25425682 Single nucleotide polymorphisms in ATIC gene is associated with acute graft-versus-host disease.
25240429 genotyping of ATIC rs2372536 and ITPA rs1127354 variants or measuring ITPA activity could be useful to predict methotrexate response in children with juvenile idiopathic arthritis.
25084201 MTHFR, DHFR and ATIC genetic variants can be considered as pharmacogenetic markers of outcome in RA patients under MTX monotherapy.
24967362 study suggests that MTHFR C677T and ATIC T675C genotyping combined with clinicopathological data may help to identify patients whom will not benefit from MTX treatment and, therefore, assist clinicians in personalizing RA treatment
22180458 Results proved in cultured skin fibroblasts from patients with AICA-ribosiduria that various mutations of ATIC destabilize to various degrees purinosome assembly.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902562 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19193698 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19016697 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18845790 ATIC associated with nucleophosmin-ALK, and its phosphorylation required ALK activity. ALK-mediated ATIC phosphorylation enhanced its enzymatic activity.
17617058 AS160 is a common target of insulin, IGF-1, EGF, PMA and AICAR, these stimuli induce distinctive patterns of phosphorylation and 14-3-3 binding, mediated by at least four protein kinases.
17530705 Observational study of gene-disease association, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
17439323 Observational study of gene-disease association. (HuGE Navigator)
17410198 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17181924 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17009228 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16947783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16447238 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15677700 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15457444 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15457444 Polymorphisms of reduced folate carrier,aminoimidazole carboxamide ribonucleotide transformylase,and thymidylate synthase genes contribute to the therapeutic response in rheumatoid arthritis patients to methotrexate.
15114530 Deficiency in AICAR transformylase is associated with severe neurological defects and congenital blindness
14966129 crystal structure of ATIC
11948179 The kinetic mechanism of the human bifunctional enzyme ATIC

AA Sequence

MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHP      1 - 70
AVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHA     71 - 140
RVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGM    141 - 210
NPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLS    211 - 280
EDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEA    281 - 350
LTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV    351 - 420
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNA    421 - 490
IDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIA    491 - 560
APSGSAADKVVIEACDELGIILAHTNLRLFHH                                          561 - 592
//

Text Mined References (57)

PMID Year Title
26799664 2016 ATIC 347C>G gene polymorphism may be associated with methotrexate-induced adverse events in south Indian Tamil rheumatoid arthritis.
25823786 2015 Correlation of genetic polymorphisms with clinical outcomes in pemetrexed-treated advanced lung adenocarcinoma patients.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25425682 2015 Cyclosporine and methotrexate-related pharmacogenomic predictors of acute graft-versus-host disease.
25240429 2015 5-Aminoimidazole-4-carboxamide ribonucleotide-transformylase and inosine-triphosphate-pyrophosphatase genes variants predict remission rate during methotrexate therapy in patients with juvenile idiopathic arthritis.
25084201 2014 Polymorphisms in genes involved in the mechanism of action of methotrexate: are they associated with outcome in rheumatoid arthritis patients?
24967362 2014 Prediction of methotrexate clinical response in Portuguese rheumatoid arthritis patients: implication of MTHFR rs1801133 and ATIC rs4673993 polymorphisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22180458 2012 Mutations of ATIC and ADSL affect purinosome assembly in cultured skin fibroblasts from patients with AICA-ribosiduria and ADSL deficiency.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902562 2009 Purine biosynthetic pathway genes and methotrexate response in rheumatoid arthritis patients among north Indians.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19193698 2009 Investigation of candidate polymorphisms and disease activity in rheumatoid arthritis patients on methotrexate.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016697 2009 Outcomes of methotrexate therapy for psoriasis and relationship to genetic polymorphisms.
18845790 2009 The enzymatic activity of 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase is enhanced by NPM-ALK: new insights in ALK-mediated pathogenesis and the treatment of ALCL.
17617058 2007 Regulation of multisite phosphorylation and 14-3-3 binding of AS160 in response to IGF-1, EGF, PMA and AICAR.
17530705 2007 A clinical pharmacogenetic model to predict the efficacy of methotrexate monotherapy in recent-onset rheumatoid arthritis.
17439323 2007 Associations of common polymorphisms in the thymidylate synthase, reduced folate carrier and 5-aminoimidazole-4-carboxamide ribonucleotide transformylase/inosine monophosphate cyclohydrolase genes with folate and homocysteine levels and venous thrombosis risk.
17410198 2007 Polymorphisms in folate, pyrimidine, and purine metabolism are associated with efficacy and toxicity of methotrexate in psoriasis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17181924 ABCB1 C3435T polymorphism influences methotrexate sensitivity in rheumatoid arthritis patients.
17009228 2006 Pharmacogenomic and metabolic biomarkers in the folate pathway and their association with methotrexate effects during dosage escalation in rheumatoid arthritis.
16947783 2006 Relationship between genetic variants in the adenosine pathway and outcome of methotrexate treatment in patients with recent-onset rheumatoid arthritis.
16447238 2006 Risk genotypes in folate-dependent enzymes and their association with methotrexate-related side effects in rheumatoid arthritis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15677700 2005 Pharmacogenetic and metabolite measurements are associated with clinical status in patients with rheumatoid arthritis treated with methotrexate: results of a multicentred cross sectional observational study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15457444 2004 Polyglutamation of methotrexate with common polymorphisms in reduced folate carrier, aminoimidazole carboxamide ribonucleotide transformylase, and thymidylate synthase are associated with methotrexate effects in rheumatoid arthritis.
15114530 2004 AICA-ribosiduria: a novel, neurologically devastating inborn error of purine biosynthesis caused by mutation of ATIC.
14966129 2004 Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates.
14756553 2004 Structural insights into the human and avian IMP cyclohydrolase mechanism via crystal structures with the bound XMP inhibitor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948179 2002 The kinetic mechanism of the human bifunctional enzyme ATIC (5-amino-4-imidazolecarboxamide ribonucleotide transformylase/inosine 5'-monophosphate cyclohydrolase). A surprising lack of substrate channeling.
11096114 2001 Human 5-aminoimidazole-4-carboxamide ribonucleotide transformylase/inosine 5'-monophosphate cyclohydrolase. A bifunctional protein requiring dimerization for transformylase activity but not for cyclohydrolase activity.
9598063 1998 Structure and functional relationships in human pur H.
9378707 1997 Characterization of molecularly cloned human 5-aminoimidazole-4-carboxamide ribonucleotide transformylase.
8867801 1995 Isolation of human purH gene expressed in the rodent transformant cells by subtractive enrichment of 3'-untranslated region of human transcript.
8567683 1996 The human purH gene product, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase. Cloning, sequencing, expression, purification, kinetic analysis, and domain mapping.
1574589 1992 De novo purine nucleotide biosynthesis.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.