Property Summary

NCBI Gene PubMed Count 50
PubMed Score 364.03
PubTator Score 159.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 7.8e-04
Disease Target Count Z-score Confidence
Cancer 2346 4.268 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.097 7.8e-04

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (29)

PMID Text
26785669 We have identified ATG7 as a potential tissue biomarker distinguishing active EoE from normal, EoE remission, and GERD.
26468292 These observations indicate that Atg7-mediated autophagy is dispensable for retinoid recycling and A2E deposition; however, autophagy plays a role in coping with stress caused by A2E accumulation.
26214133 Inhibition of Atg7-mediated autophagy within the epithelium may prevent the development and progression of colorectal cancer in genetically predisposed patients.
26043688 The region of human ATG3 that interacts with ATG7 is precisely identified using nuclear magnetic resonance.
25339774 The siRNA-mediated reduction of ATG7 protein reverses Torin-1-induced HIV-1 Tat degradation, suggesting ATG7 is involved in the lysosomal-mediated Tat degradation
24362031 the Atg7.caspase-9 complex performs a dual function of linking caspase-9 to the autophagic process while keeping in check its apoptotic activity.
24023838 a protective mechanism for Atg4B, Atg3 and LC3-Atg3 conjugate from being inappropriately sequestered into p62 aggregates
23894380 the polymorphism is associated with a 6-years earlier disease onset
23640897 Data indicate mitogen lacritin stimulates FOXO3-ATG101 and FOXO1-ATG7 autophagic coupling and restores metabolic homeostasis.
23527187 2-methoxyestradiol-dependent autophagosome formation in osteosarcoma cells requires ATG7 expression.
23386620 Heat shock factor 1 (HSF1) controls chemoresistance and autophagy through transcriptional regulation of autophagy-related protein 7 (ATG7)
23295909 the sequence variants within the ATG7 gene promoter identified in PD patients may change ATG7 protein levels, which in turn would influence autophagic activity, contributing to Parkinson disease onset as a risk factor.
22927446 tetrandrine transcriptionally regulated the expression of autophagy related gene 7 (ATG7), which promoted tetrandrine-induced autophagy.
22499945 when nutrients are limited, Atg7 regulates p53-dependent cell cycle and cell death pathways
22170151 The FAP motif of ATG7 is indispensable for formation of the ATG3-LC3 E2-substrate intermediate through the interaction of ATG7 with ATG3.
21655094 Data show that both EGFR-TKIs increased ATG5 and ATG7 at the mRNA or protein levels (Figure 3), confirming the induction of autophagy by EGFR-TKIs.
21274862 Knockdown of autophagy-related protein beclin 1 (BCN1) or autophagy-related protein 7 (ATG7) in immortalized human hepatocytes (IHHs) inhibits hepatitis C virus growth.
20697744 Data show that polymorphism in the Atg7 gene that substitutes alanine for valine (V471A) was associated with an earlier disease onset of 4 years.
20697744 Observational study of gene-disease association. (HuGE Navigator)
20543840 In response to stress, FoxO1 was acetylated by dissociation from sirtuin-2 (SIRT2), a NAD(+)-dependent histone deacetylase, and the acetylated FoxO1 bound to Atg7.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20083906 Data suggest that apoptosis-deficient cells rely on autophagy for cell death after Pc 4-PDT and that the strong activation of LC3 maturation in response to PDT could occur even in cells with limited or no Atg7 expression.
19881538 Data show that proteasome inhibition promoted autophagosome formation, stimulated autophagic flux, and upregulated expression of the autophagy-specific genes ATG5 and ATG7.
19635843 The siRNA-mediated reduction of ATG7 protein reverses Torin-1-induced HIV-1 Tat degradation, suggesting ATG7 is involved in the lysosomal-mediated Tat degradation
19148225 The UBQLN protective effect requires the autophagy-related genes ATG5 and ATG7, two essential components of autophagy.
19124466 Knockdown of p300 reduces acetylation of Atg5, Atg7, Atg8, and Atg12, although overexpressed p300 increases the acetylation of these same proteins.
18688877 The suppression of unfolded protein response or the suppression of expression of LC3 or Atg7, a protein that mediates LC3 lipidation, suppressed HCV replication.
18187620 Knockdown of autophagy related 7 homolog (ATG7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16704426 Murine Atg8L/Apg8L modification is mediated by human Atg7.

AA Sequence

MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAF      1 - 70
DMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLK     71 - 140
KYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLV    141 - 210
SLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVA    211 - 280
HSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDL    281 - 350
DKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR    351 - 420
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAAS    421 - 490
KRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPG    491 - 560
DSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFL    561 - 630
SRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDD    631 - 700
ETI                                                                       701 - 703
//

Text Mined References (59)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
26785669 2016 ATG7 Gene Expression as a Novel Tissue Biomarker in Eosinophilic Esophagitis.
26468292 2015 Di-retinoid-pyridinium-ethanolamine (A2E) Accumulation and the Maintenance of the Visual Cycle Are Independent of Atg7-mediated Autophagy in the Retinal Pigmented Epithelium.
26214133 2015 Intestinal inhibition of Atg7 prevents tumour initiation through a microbiome-influenced immune response and suppresses tumour growth.
26043688 2015 Identification and characterization of the linear region of ATG3 that interacts with ATG7 in higher eukaryotes.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24681637 2014 Atg7- and Keap1-dependent autophagy protects breast cancer cell lines against mitoquinone-induced oxidative stress.
24362031 2014 A Complex between Atg7 and Caspase-9: A NOVEL MECHANISM OF CROSS-REGULATION BETWEEN AUTOPHAGY AND APOPTOSIS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
24023838 2013 E1-like activating enzyme Atg7 is preferentially sequestered into p62 aggregates via its interaction with LC3-I.
23894380 2013 The V471A polymorphism in autophagy-related gene ATG7 modifies age at onset specifically in Italian Huntington disease patients.
23640897 2013 Lacritin rescues stressed epithelia via rapid forkhead box O3 (FOXO3)-associated autophagy that restores metabolism.
23527187 2013 RNA-dependent protein kinase is essential for 2-methoxyestradiol-induced autophagy in osteosarcoma cells.
23386620 2013 Heat shock factor 1 (HSF1) controls chemoresistance and autophagy through transcriptional regulation of autophagy-related protein 7 (ATG7).
23295909 2013 Genetic analysis of the ATG7 gene promoter in sporadic Parkinson's disease.
23290079 2013 Human papillomavirus infection is inhibited by host autophagy in primary human keratinocytes.
22927446 2012 Autophagy-related gene 7 (ATG7) and reactive oxygen species/extracellular signal-regulated kinase regulate tetrandrine-induced autophagy in human hepatocellular carcinoma.
22499945 2012 Atg7 modulates p53 activity to regulate cell cycle and survival during metabolic stress.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22170151 2012 The FAP motif within human ATG7, an autophagy-related E1-like enzyme, is essential for the E2-substrate reaction of LC3 lipidation.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21655094 2011 EGFR tyrosine kinase inhibitors activate autophagy as a cytoprotective response in human lung cancer cells.
21274862 2011 Knockdown of autophagy enhances the innate immune response in hepatitis C virus-infected hepatocytes.
21269460 2011 Initial characterization of the human central proteome.
20723759 2010 ATG12 conjugation to ATG3 regulates mitochondrial homeostasis and cell death.
20697744 2010 Age at onset in Huntington's disease is modified by the autophagy pathway: implication of the V471A polymorphism in Atg7.
20562859 2010 Network organization of the human autophagy system.
20543840 2010 Cytosolic FoxO1 is essential for the induction of autophagy and tumour suppressor activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20083906 2010 Atg7 deficiency increases resistance of MCF-7 human breast cancer cells to photodynamic therapy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19881538 2010 Proteasome inhibitors activate autophagy as a cytoprotective response in human prostate cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19279012 2009 Loss of PINK1 function promotes mitophagy through effects on oxidative stress and mitochondrial fission.
19148225 2009 PLIC proteins or ubiquilins regulate autophagy-dependent cell survival during nutrient starvation.
19124466 2009 Regulation of autophagy by the p300 acetyltransferase.
18688877 2008 Induction of incomplete autophagic response by hepatitis C virus via the unfolded protein response.
18083104 2007 Homeostatic levels of p62 control cytoplasmic inclusion body formation in autophagy-deficient mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16704426 2006 Atg8L/Apg8L is the fourth mammalian modifier of mammalian Atg8 conjugation mediated by human Atg4B, Atg7 and Atg3.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303767 2006 Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12890687 2003 The mouse APG10 homologue, an E2-like enzyme for Apg12p conjugation, facilitates MAP-LC3 modification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11890701 2002 Murine Apg12p has a substrate preference for murine Apg7p over three Apg8p homologs.
11825910 2002 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.
11096062 2001 The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.
10233149 1999 Glucose-induced autophagy of peroxisomes in Pichia pastoris requires a unique E1-like protein.