Property Summary

NCBI Gene PubMed Count 34
PubMed Score 46.45
PubTator Score 30.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.1e-06
psoriasis 6685 2.9e-04
osteosarcoma 7933 1.5e-03
breast carcinoma 1614 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.400 2.9e-04
osteosarcoma -1.195 1.5e-03
breast carcinoma 1.300 1.2e-02
ovarian cancer 1.500 1.1e-06

Protein-protein Interaction (3)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504462 screening 1735 / 0 / 338616 uHTS fluorescent assay for identification of inhibitors of ATG4B
504475 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of ATG4B
504756 confirmatory 289 / 0 / 29 Dose response confirmation of the uHTS fluorescent assay for identification of inhibitors of ATG4B.
504757 screening 291 / 0 / 27 Single concentration confirmation of inhibitors of ATG4B via a fluorescent assay
588584 confirmatory 3 / 0 / 13 Dose response confirmation of the uHTS fluorescent assay for identification of inhibitors of ATG4B Set 2

Gene RIF (12)

PMID Text
26499184 Results demonstrated that upregulation of miR-34a by transfection or demethylation resulted in the enhanced apoptosis and drug sensitivity in prostate cancer cells. ATG4B, directly regulated by miR-34a through AMPK/mTOR, was involved in this process.
25652856 Purified ATG4B protein interact with LC3B in vitro.
25490467 HIV-1 Vif binds more strongly to autophagy-related protein 4 (ATG4)-cleaved form I (LC3-I) than to ATG4-cleaved form II (LC3-II) in an A3G-independent manner
24991826 ATG4B independently plays a role as a positive regulator on tumor proliferation and a negative regulator on autophagy in colorectal cancer cells.
24755409 This study identifies ATG4B as a potential biomarker for predicting therapeutic response in treatment-naive chronic myeloid leukemia stem/progenitor cells and uncovers ATG4B as a possible drug target in these cells.
23508006 The actions of ATG4 family members (particularly ATG4B) are required for the control of autophagosome fusion with late, degradative compartments in differentiating human erythroblasts.
21177865 Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates
19322194 The crystal structures of catalytically inert human Atg4B in complex with processed and unprocessed forms of LC3 showed that, on LC3 binding, the regulatory loop and the N-terminal tail of HsAtg4B undergo large conformational changes.
16704426 Murine Atg8L/Apg8L modification is mediated by human Atg4B.
16325851 crystal structure of human Atg4b by X-ray crystallography at 2.0 A resolution, and show that Atg4b is a cysteine protease whose active catalytic triad site consists of Cys74, His280 and Asp278
16183633 analysis of specificity and catalysis of HsAtg4B
15187094 HsAtg4B negatively regulates the localization of LC3 to a membrane compartment by delipidation

AA Sequence

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT      1 - 70
GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG     71 - 140
QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA    141 - 210
EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH    211 - 280
TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE    281 - 350
LVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL                               351 - 393
//

Text Mined References (47)

PMID Year Title
26499184 2016 Methylation-induced silencing of miR-34a enhances chemoresistance by directly upregulating ATG4B-induced autophagy through AMPK/mTOR pathway in prostate cancer.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
25652856 2015 [The expression, purification and characterization of human His-ATG4B protein].
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24991826 2014 ATG4B promotes colorectal cancer growth independent of autophagic flux.
24755409 2014 The core autophagy protein ATG4B is a potential biomarker and therapeutic target in CML stem/progenitor cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23508006 2013 Autophagy facilitates organelle clearance during differentiation of human erythroblasts: evidence for a role for ATG4 paralogs during autophagosome maturation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22302004 2012 A high-throughput FRET-based assay for determination of Atg4 activity.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21177865 2011 Kinetics comparisons of mammalian Atg4 homologues indicate selective preferences toward diverse Atg8 substrates.
20562859 2010 Network organization of the human autophagy system.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010802 2010 Nix is a selective autophagy receptor for mitochondrial clearance.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19322194 2009 The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
18387192 2008 A pathway sensor for genome-wide screens of intracellular proteolytic cleavage.
18083104 2007 Homeostatic levels of p62 control cytoplasmic inclusion body formation in autophagy-deficient mice.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17347651 2007 Reactive oxygen species are essential for autophagy and specifically regulate the activity of Atg4.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16704426 2006 Atg8L/Apg8L is the fourth mammalian modifier of mammalian Atg8 conjugation mediated by human Atg4B, Atg7 and Atg3.
16381901 2006 The LIFEdb database in 2006.
16325851 2006 The crystal structure of human Atg4b, a processing and de-conjugating enzyme for autophagosome-forming modifiers.
16183633 2005 Structural basis for the specificity and catalysis of human Atg4B responsible for mammalian autophagy.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355958 2004 Human light chain 3/MAP1LC3B is cleaved at its carboxyl-terminal Met121 to expose Gly120 for lipidation and targeting to autophagosomal membranes.
15187094 2004 HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates.
15169837 2004 LC3, GABARAP and GATE16 localize to autophagosomal membrane depending on form-II formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446702 2003 Human autophagins, a family of cysteine proteinases potentially implicated in cell degradation by autophagy.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.