Property Summary

NCBI Gene PubMed Count 24
PubMed Score 62.99
PubTator Score 38.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.900 5.1e-07
psoriasis 1.100 2.8e-04
osteosarcoma -1.840 3.6e-06
juvenile dermatomyositis 1.072 6.5e-08
acute quadriplegic myopathy 1.018 3.5e-04
ovarian cancer 2.100 2.3e-04

 GWAS Trait (1)

Gene RIF (11)

PMID Text
26061804 ATG3 upregulation contributes to autophagy induced by the detachment of intestinal epithelial cells from the extracellular matrix, but promotes autophagy-independent apoptosis of the attached cells
26043688 The region of human ATG3 that interacts with ATG7 is precisely identified using nuclear magnetic resonance.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24420857 ATG3 gene and its gene family may play an important role in transformation of myelodysplastic syndrome.
24191030 13 residues of the ATG3 fragment form a short beta-strand followed by an alpha-helix on a surface area that is an exclusive binding site for ATG12.
24186333 Hidden Markov models were used to detect protein homology among the flexible regions of Atg3 homologs and importance of conserved regions evaluated by performing affinity capture experiments with human Atg3 deletion constructs; binding studies and competition experiments demonstrate that overlapping sites in the Atg3FR are important for E3 binding and E1 binding.
22644571 caspase-8 overexpression led to Atg3 degradation and this event depended on caspase-8 enzymatic activity
20723759 These results unveil a role for ATG12-ATG3 in mitochondrial homeostasis and implicate the ATG12 conjugation system in cellular functions distinct from the early steps of autophagosome formation.
20697744 Observational study of gene-disease association. (HuGE Navigator)
16704426 Murine Atg8L/Apg8L modification is mediated by human Atg3.
11825910 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p

AA Sequence

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG      1 - 70
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS     71 - 140
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY    141 - 210
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG    211 - 280
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM                                        281 - 314
//

Text Mined References (32)

PMID Year Title
26061804 2015 Upregulation of ATG3 contributes to autophagy induced by the detachment of intestinal epithelial cells from the extracellular matrix, but promotes autophagy-independent apoptosis of the attached cells.
26043688 2015 Identification and characterization of the linear region of ATG3 that interacts with ATG7 in higher eukaryotes.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24420857 2014 Lentiviral vector-mediate ATG3 overexpression inhibits growth and promotes apoptosis of human SKM-1 cells.
24191030 2013 Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
24186333 2013 Binding to E1 and E3 is mutually exclusive for the human autophagy E2 Atg3.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23119048 2012 Combination erlotinib-cisplatin and Atg3-mediated autophagy in erlotinib resistant lung cancer.
22644571 2012 Cleavage of Atg3 protein by caspase-8 regulates autophagy during receptor-activated cell death.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22170151 2012 The FAP motif within human ATG7, an autophagy-related E1-like enzyme, is essential for the E2-substrate reaction of LC3 lipidation.
21269460 2011 Initial characterization of the human central proteome.
20723759 2010 ATG12 conjugation to ATG3 regulates mitochondrial homeostasis and cell death.
20697744 2010 Age at onset in Huntington's disease is modified by the autophagy pathway: implication of the V471A polymorphism in Atg7.
20562859 2010 Network organization of the human autophagy system.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19342671 2009 A novel hybrid yeast-human network analysis reveals an essential role for FNBP1L in antibacterial autophagy.
18083104 2007 Homeostatic levels of p62 control cytoplasmic inclusion body formation in autophagy-deficient mice.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16704426 2006 Atg8L/Apg8L is the fourth mammalian modifier of mammalian Atg8 conjugation mediated by human Atg4B, Atg7 and Atg3.
16303767 2006 Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355958 2004 Human light chain 3/MAP1LC3B is cleaved at its carboxyl-terminal Met121 to expose Gly120 for lipidation and targeting to autophagosomal membranes.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12890687 2003 The mouse APG10 homologue, an E2-like enzyme for Apg12p conjugation, facilitates MAP-LC3 modification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207896 2002 Mammalian Apg12p, but not the Apg12p.Apg5p conjugate, facilitates LC3 processing.
11825910 2002 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.