Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.18
PubTator Score 3.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 5.5e-04
non-small cell lung cancer -1.188 2.2e-20
osteosarcoma -2.478 6.2e-05
Rheumatoid arthritis 2.000 1.7e-02
subependymal giant cell astrocytoma 1.348 3.4e-02
tuberculosis 2.200 4.9e-09

Gene RIF (7)

AA Sequence

MAGPGVPGAPAARWKRHIVRQLRLRDRTQKALFLELVPAYNHLLEKAELLDKFSKKLQPEPNSVTPTTHQ      1 - 70
GPWEESELDSDQVPSLVALRVKWQEEEEGLRLVCGEMAYQVVEKGAALGTLESELQQRQSRLAALEARVA     71 - 140
QLREARAQQAQQVEEWRAQNAVQRAAYEALRAHVGLREAALRRLQEEARDLLERLVQRKARAAAERNLRN    141 - 210
ERRERAKQARVSQELKKAAKRTVSISEGPDTLGDGMRERRETLALAPEPEPLEKEACEKWKRPFRSASAT    211 - 280
SLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNSSL    281 - 350
LATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSG    351 - 420
HKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGHNDQKIRFWDS    421 - 490
RGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVFRADGFKCGSDWTKAVFSPDR    491 - 560
SYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWCYSGSHMVSVDQGRKVVLWQ               561 - 619
//

Text Mined References (11)

PMID Year Title