Property Summary

NCBI Gene PubMed Count 30
PubMed Score 34.99
PubTator Score 26.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.3e-13
osteosarcoma 7933 1.0e-06
psoriasis 6685 5.0e-04
acute myeloid leukemia 785 4.1e-02
spina bifida 1064 4.3e-02
Disease Target Count Z-score Confidence
Vici syndrome 16 3.854 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 5.0e-04
osteosarcoma -2.122 1.0e-06
spina bifida -1.383 4.3e-02
acute myeloid leukemia 2.000 4.1e-02
ovarian cancer -2.200 1.3e-13

Gene RIF (13)

PMID Text
25686604 data suggest an autophagy-specific membrane fusion mechanism in which oligomeric ATG14 directly binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion
24337183 Cisplatin upregulated Barkor protein levels of the Saos-2 cell line.
23878393 Atg14 is critical in controlling an autophagy-dependent phosphorylation of beclin-1. We map novel phosphorylation sites to serines 90 and 93 and demonstrate that phosphorylation at these sites is necessary for maximal autophagy.
23197835 Anaplasma actively induces autophagy by secreting Ats-1 that hijacks the Beclin 1-Atg14L autophagy initiation pathway likely to acquire host nutrients for its growth
22992773 Atg14 is a new target gene of FoxOs and the core clock machinery, and this gene plays an important role in hepatic lipid metabolism
22797916 Our findings reveal that Atg14L, previously considered to be solely a Beclin 1-binding autophagy protein, plays a novel role in the late stage of endocytic trafficking in conjunction with Snapin
22314358 analysis of how the Beclin1 coiled-coil domain interface regulates homodimer and heterodimer formation with Atg14L and UVRAG
20713597 Data suggest that the Atg14L-dependent appearance of phosphatidylinositol 3-phosphate in the endoplasmic reticulum makes this organelle the platform for autophagosome formation.
19460752 Knockdown of ATG14 autophagy related 14 homolog (S. cerevisiae, ATG14) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19270696 Two Beclin 1 associated proteins, Atg14L and Rubicon, were identified.
19050071 study defines a regulatory signaling pathway mediated by Barkor (KIAA0831) that positively controls autophagy through Beclin 1
19050071 Barkor/KIAA0831 functions as an autophagy targeting factor for Beclin 1 and the class III PI3 kinase. Barkor and UVRAG form two distinct protein complexes with the core class III PI3 kinase. Barkor is a functional ortholog of yeast Atg14.
18843052 These results suggest that mammalian cells have at least two distinct class III PI3-kinase complexes, and that beclin 1 interacts distinctly with mammalian Atg14 and UVRAG in two of these complexes.

AA Sequence

MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGR      1 - 70
DRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEG     71 - 140
LLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEE    141 - 210
VKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYY    211 - 280
SWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKK    281 - 350
LNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG    351 - 420
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTG    421 - 490
HR                                                                        491 - 492
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24337183 2014 Silencing of Barkor/ATG14 sensitizes osteosarcoma cells to cisplatin?induced apoptosis.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23878393 2013 Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy.
23332761 2013 Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy.
23197835 2012 Autophagosomes induced by a bacterial Beclin 1 binding protein facilitate obligatory intracellular infection.
22992773 2012 The autophagy-related gene 14 (Atg14) is regulated by forkhead box O transcription factors and circadian rhythms and plays a critical role in hepatic autophagy and lipid metabolism.
22797916 2012 Beclin-1-interacting autophagy protein Atg14L targets the SNARE-associated protein Snapin to coordinate endocytic trafficking.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22314358 2012 Imperfect interface of Beclin1 coiled-coil domain regulates homodimer and heterodimer formation with Atg14L and UVRAG.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
21518905 2011 Autophagosome targeting and membrane curvature sensing by Barkor/Atg14(L).
21062745 2011 The RUN domain of rubicon is important for hVps34 binding, lipid kinase inhibition, and autophagy suppression.
20713597 2010 Autophagy requires endoplasmic reticulum targeting of the PI3-kinase complex via Atg14L.
20562859 2010 Network organization of the human autophagy system.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19270696 2009 Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages.
19050071 2008 Identification of Barkor as a mammalian autophagy-specific factor for Beclin 1 and class III phosphatidylinositol 3-kinase.
18843052 2008 Beclin 1 forms two distinct phosphatidylinositol 3-kinase complexes with mammalian Atg14 and UVRAG.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.