Property Summary

NCBI Gene PubMed Count 32
PubMed Score 105.95
PubTator Score 66.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.5e-11
juvenile dermatomyositis 1189 2.5e-08
psoriasis 6685 3.2e-04
Multiple myeloma 1327 3.5e-04
medulloblastoma, large-cell 6234 1.4e-03
osteosarcoma 7933 5.5e-03
lung cancer 4473 4.8e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.404 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.067 3.5e-04
psoriasis -1.400 3.2e-04
osteosarcoma 1.295 5.5e-03
medulloblastoma, large-cell -1.100 1.4e-03
juvenile dermatomyositis 1.194 2.5e-08
lung cancer 1.600 4.8e-02
ovarian cancer -2.300 7.5e-11

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (15)

PMID Text
25629932 reveal a novel interconnection between autophagy, proteasome activity, and cell death mediated by the ubiquitin-like properties of ATG12
25439980 Analysis of hepatitis B virus capsid maturation steps revealed that Rab33B and Atg5/12/16L1 are required for proper particle assembly and/or stability.
24899049 The results revealed that the expression of Atg12 and LC3 II/LC3 I in the chondrocytes treated with TXC increased, compared to that in the untreated chondrocytes
24727585 Cav-1 competitively interacts with the ATG12-ATG5 system to suppress the formation and function of the latter in lung epithelial cells.
23307622 ATG12 is a novel determinant of breast cancer primary resistance to HER1/2-targeted therapeutics.
23202584 study to identify role of conjugation between ATG12 and ATG5 in LC3 lipidation; structural and mutational analyses of ATG12~ATG5-ATG16N revealed the conjugation generates a patch across ATG12 and ATG5 required for E3 activity
22170153 These data relate LC3B, ATG5 and ATG12 to mitochondrial quality control after oxidative damage, and to cellular longevity.
22152474 The Atg12 is as a positive mediator of mitochondrial apoptosis and show that Atg12 directly regulates the apoptotic pathway by binding and inactivating prosurvival Bcl-2 family members, including Bcl-2 and Mcl-1.
19901552 Calpain1 plays an important role in controlling the levels of autophagy in normal living cells by regulating the levels of a key signaling molecule, ATG12-ATG5 conjugate.
19197948 Observational study of gene-disease association. (HuGE Navigator)
19124466 Knockdown of p300 reduces acetylation of Atg5, Atg7, Atg8, and Atg12, although overexpressed p300 increases the acetylation of these same proteins.
18187620 Knockdown of autophagy related 12 homolog (ATG12) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17457038 Mitochondrial DNA deletions and chloramphenicol treatment stimulate APG12.
12207896 Apg12p, but not the Apg12p.Apg5p conjugate, facilitates LC3 processing
11825910 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p

AA Sequence

MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKT      1 - 70
KKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG     71 - 140
//

Text Mined References (43)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
25629932 2014 Ubiquitination and proteasomal degradation of ATG12 regulates its proapoptotic activity.
25439980 2015 Rab33B and its autophagic Atg5/12/16L1 effector assist in hepatitis B virus naked capsid formation and release.
25416956 2014 A proteome-scale map of the human interactome network.
24899049 2014 Tougu Xiaotong capsule promotes chondrocyte autophagy by regulating the Atg12/LC3 conjugation systems.
24727585 2014 Interaction of caveolin-1 with ATG12-ATG5 system suppresses autophagy in lung epithelial cells.
23307622 2012 Autophagy-related gene 12 (ATG12) is a novel determinant of primary resistance to HER2-targeted therapies: utility of transcriptome analysis of the autophagy interactome to guide breast cancer treatment.
23202584 2013 Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
22342342 2012 A mammalian autophagosome maturation mechanism mediated by TECPR1 and the Atg12-Atg5 conjugate.
22170153 2012 Autophagy proteins LC3B, ATG5 and ATG12 participate in quality control after mitochondrial damage and influence lifespan.
22152474 2011 The autophagy protein Atg12 associates with antiapoptotic Bcl-2 family members to promote mitochondrial apoptosis.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
19901552 2010 Control of basal autophagy by calpain1 mediated cleavage of ATG5.
19666601 2009 The autophagy machinery is required to initiate hepatitis C virus replication.
19473119 2009 Nicotinamide enhances mitochondria quality through autophagy activation in human cells.
19197948 2009 Frameshift mutations of autophagy-related genes ATG2B, ATG5, ATG9B and ATG12 in gastric and colorectal cancers with microsatellite instability.
19164948 2009 Effect of Helicobacter pylori's vacuolating cytotoxin on the autophagy pathway in gastric epithelial cells.
19124466 2009 Regulation of autophagy by the p300 acetyltransferase.
19074260 2008 Ubiquitin signals autophagic degradation of cytosolic proteins and peroxisomes.
18704115 2008 The Atg8 and Atg12 ubiquitin-like conjugation systems in macroautophagy. 'Protein modifications: beyond the usual suspects' review series.
17999726 2008 Induction of autophagy promotes fusion of multivesicular bodies with autophagic vacuoles in k562 cells.
17709747 2007 The Atg5 Atg12 conjugate associates with innate antiviral immune responses.
17457038 Mitochondrial DNA deletions and chloramphenicol treatment stimulate the autophagic transcript ATG12.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16963840 Stimulation of ATG12-ATG5 conjugation by ribonucleic acid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665549 2003 Mouse Apg16L, a novel WD-repeat protein, targets to the autophagic isolation membrane with the Apg12-Apg5 conjugate.
12482611 2002 Mouse Apg10 as an Apg12-conjugating enzyme: analysis by the conjugation-mediated yeast two-hybrid method.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207896 2002 Mammalian Apg12p, but not the Apg12p.Apg5p conjugate, facilitates LC3 processing.
11890701 2002 Murine Apg12p has a substrate preference for murine Apg7p over three Apg8p homologs.
11825910 2002 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.
11096062 2001 The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.
9852036 1998 A new protein conjugation system in human. The counterpart of the yeast Apg12p conjugation system essential for autophagy.
9490301 1998 Cloning and tissue expression of cDNAs from chromosome 5q21-22 which is frequently deleted in advanced lung cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.