Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.06
PubTator Score 18.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.6e-02
group 4 medulloblastoma -1.100 3.7e-03
osteosarcoma -1.384 1.6e-04
ovarian cancer 1.200 2.0e-04
subependymal giant cell astrocytoma 1.107 4.5e-02
tuberculosis 1.400 1.6e-05

Gene RIF (8)

AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLP      1 - 70
MEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRL     71 - 140
LQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAK    141 - 210
ATSQDERNVP                                                                211 - 220
//

Text Mined References (29)

PMID Year Title