Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.84
PubTator Score 18.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.6e-02
osteosarcoma -1.384 1.6e-04
tuberculosis 1.400 1.6e-05
group 4 medulloblastoma -1.100 3.7e-03
subependymal giant cell astrocytoma 1.107 4.5e-02
ovarian cancer 1.200 2.0e-04

Gene RIF (4)

PMID Text
26151773 3 novel miRNAs, MIR4458, MIR4667-5p, and MIR4668-5p, regulate autophagy-mediated elimination of B. pseudomallei by targeting ATG10
23850577 results suggest that genetic variants in ATG10 may implicate with breast cancer susceptibility in Chinese population. Further large and functional studies are needed to confirm our findings
23285162 Increased expression of ATG10 in colorectal cancer is associated with lymphovascular invasion and lymph node metastasis indicating that ATG10 may be a potential prognostic maker in colorectal cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLP      1 - 70
MEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRL     71 - 140
LQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAK    141 - 210
ATSQDERNVP                                                                211 - 220
//

Text Mined References (25)

PMID Year Title
26151773 2015 Burkholderia pseudomallei survival in lung epithelial cells benefits from miRNA-mediated suppression of ATG10.
23850577 2013 Potentially functional polymorphisms in ATG10 are associated with risk of breast cancer in a Chinese population.
23285162 2012 Increased expression of ATG10 in colorectal cancer is associated with lymphovascular invasion and lymph node metastasis.
22174682 2011 IRGM is a common target of RNA viruses that subvert the autophagy network.
21367888 2011 Human adenovirus type 5 induces cell lysis through autophagy and autophagy-triggered caspase activity.
20723759 2010 ATG12 conjugation to ATG3 regulates mitochondrial homeostasis and cell death.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17256008 2007 Regulation of autophagy by the inositol trisphosphate receptor.
16963840 Stimulation of ATG12-ATG5 conjugation by ribonucleic acid.
16381901 2006 The LIFEdb database in 2006.
15657430 2005 Inhibition of macroautophagy triggers apoptosis.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12890687 2003 The mouse APG10 homologue, an E2-like enzyme for Apg12p conjugation, facilitates MAP-LC3 modification.
12482611 2002 Mouse Apg10 as an Apg12-conjugating enzyme: analysis by the conjugation-mediated yeast two-hybrid method.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2890687 1987 Beta-adrenergic-receptor-mediated suppression of interleukin 2 receptors in human lymphocytes.