Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.80
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.188 2.0e-02
astrocytic glioma -1.400 2.4e-03
cutaneous lupus erythematosus 1.100 3.6e-02
ependymoma -1.300 1.7e-02
glioblastoma -1.100 4.4e-04
interstitial cystitis -1.300 1.3e-02
lung cancer -3.200 1.5e-05
oligodendroglioma -1.600 3.2e-03
osteosarcoma -2.070 5.3e-05
ovarian cancer -2.000 1.0e-08
pancreatic ductal adenocarcinoma liver m... -1.104 1.9e-03
pituitary cancer -1.100 3.1e-02
psoriasis -1.200 1.2e-02
tuberculosis and treatment for 6 months 1.200 1.4e-05

Gene RIF (2)

AA Sequence

MASPDRSKRKILKAKKTMPLSCRKQVEMLNKSRNVEALKTAIGSNVPSGNQSFSPSVITRTTEITKCSPS      1 - 70
ENGASSLDSNKNSISEKSKVFSQNCIKPVEEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNT     71 - 140
SENDSEHQTNVTRSLFEHEGACSLKSSCCPPSVLSGVVQMPESTVTSTVGDKKTDQMVFHLETNSNSESH    141 - 210
DKRQSDNILCSEDSGFVPVEKTPNLVNSVTSNNCADDILKTDECSRTSISNCESADSTWQSSLDTNNNSH    211 - 280
YQKKRMFSENEENVKRMKTSEQINENICVSLERQTAFLEQVRHLIQQEIYSINYELFDKKLKELNQRIGK    281 - 350
TECRNKHEGIADKLLAKIAKLQRRIKTVLLFQRNCLKPNMLSSNGASKVANSEAMILDKNLESVNSPIEK    351 - 420
SSVNYEPSNPSEKGSKKINLSSDQNKSVSESNNDDVMLISVESPNLTTPITSNPTDTRKITSGNSSNSPN    421 - 490
AEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPP    491 - 560
APLPELVDKTRDTLPPQKPELKVKRVFRPNGIALTWNITKINPKCAPVESYHLFLCHENSNNKLIWKKIG    561 - 630
EIKALPLPMACTLSQFLASNRYYFTVQSKDIFGRYGPFCDIKSIPGFSENLT                      631 - 682
//

Text Mined References (10)

PMID Year Title