Property Summary

NCBI Gene PubMed Count 33
PubMed Score 59.40
PubTator Score 23.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.239 3.8e-05
atypical teratoid / rhabdoid tumor 1.200 1.8e-03
glioblastoma 1.100 5.4e-03
medulloblastoma, large-cell 1.500 9.1e-05
intraductal papillary-mucinous neoplasm ... 1.700 3.5e-04

Gene RIF (7)

PMID Text
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26148593 It is negatively related between ATF7 expression and pathological stage and positive correlation with OS and PFS in CRC. ATF7 expression is a favorable factor for survival of patients with CRC.
26101806 mitotic stabilized ATF7 protein re-localizes onto chromatin at the end of telophase and contributes to induce the cyclin D1 gene expression.
25545367 These results suggest that the Cdk1-mediated phosphorylation of ATF7 facilitates G2/M progression, at least in part, by enabling Aurora signaling.
23426901 ATF7 interacts with TAF12 and contributes to the hypersensitivity of OCL precursors to 1,25-(OH)D in PD.
21858082 Data show that ATF7-4 is an important cytoplasmic negative regulator of ATF7 and ATF2 transcription factors.
18950637 The authors characterized the multisite phosphorylation of the ATF7 activation domain and identified one of the involved kinase, p38beta2 mitogen-activated protein kinase.

AA Sequence

MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNEL      1 - 70
ASSFEHEFKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSP     71 - 140
PLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHL    141 - 210
ANGQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVS    211 - 280
SINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFL    281 - 350
ERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQG    351 - 420
YLESPKESSEPTGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVIMTPQSQ    421 - 490
SAGR                                                                      491 - 494
//

Text Mined References (43)

PMID Year Title
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26148593 Expression of activating transcription factor 7 is correlated with prognosis of colorectal cancer.
26101806 2015 ATF7 is stabilized during mitosis in a CDK1-dependent manner and contributes to cyclin D1 expression.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25545367 2014 Cdk1-mediated phosphorylation of human ATF7 at Thr-51 and Thr-53 promotes cell-cycle progression into M phase.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23426901 2013 Role of ATF7-TAF12 interactions in the vitamin D response hypersensitivity of osteoclast precursors in Paget's disease.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21858082 2011 A cytoplasmic negative regulator isoform of ATF7 impairs ATF7 and ATF2 phosphorylation and transcriptional activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
18950637 2008 p38beta2-mediated phosphorylation and sumoylation of ATF7 are mutually exclusive.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17264123 2007 Sumoylation delays the ATF7 transcription factor subcellular localization and inhibits its transcriptional activity.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15735663 2005 A functional interaction between ATF7 and TAF12 that is modulated by TAF4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643450 2003 Enhanced cell cycle progression and down regulation of p21(Cip1/Waf1) by PRL tyrosine phosphatases.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278933 2001 ATF-7, a novel bZIP protein, interacts with the PRL-1 protein-tyrosine phosphatase.
10698518 2000 Cofactor competition between the ligand-bound oestrogen receptor and an intron 1 enhancer leads to oestrogen repression of ERBB2 expression in breast cancer.
10376527 1999 Role of the ATFa/JNK2 complex in Jun activation.
8939888 1996 Structure and expression of the ATFa gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8649858 1996 In vivo association of ATFa with JNK/SAP kinase activities.
8417352 1993 Transcriptional activation by the adenovirus larger E1a product is mediated by members of the cellular transcription factor ATF family which can directly associate with E1a.
8290251 1994 Jun and Fos heterodimerize with ATFa, a member of the ATF/CREB family and modulate its transcriptional activity.
8288576 1994 ATF-a0, a novel variant of the ATF/CREB transcription factor family, forms a dominant transcription inhibitor in ATF-a heterodimers.
1827203 1991 Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity.
1694576 1990 Isolation and characterization of two novel, closely related ATF cDNA clones from HeLa cells.