Property Summary

NCBI Gene PubMed Count 54
PubMed Score 80.28
PubTator Score 54.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 646
Disease Target Count P-value
lung carcinoma 2755 2.1e-07
Disease Target Count Z-score Confidence
West Nile fever 7 3.37 1.7
Cancer 2388 3.144 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 2.1e-07

Gene RIF (37)

AA Sequence

MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTER      1 - 70
VDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPS     71 - 140
LPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDR    141 - 210
KQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTR    211 - 280
SC                                                                        281 - 282
//

Text Mined References (56)

PMID Year Title