Property Summary

NCBI Gene PubMed Count 174
PubMed Score 529.05
PubTator Score 303.98

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1389 screening 2 / 0 / 9 Determination of inhibition of thapsigargin-initiated ATF-4 protein induction in ER stress signaling.

Gene RIF (130)

PMID Text
26884600 The activation of ATF4 in response to ONC201 required the kinases HRI and PKR, which phosphorylate and activate the translation initiation factor eIF2alpha.
26771712 Inhibition or overexpression of ATF4 confirms the role of ATF4 in SESN2 gene up-regulation induced by mitochondrial dysfunction.
26648175 ATF4 and ATF6beta act synergistically in the negative regulation of placental growth factor mRNA expression
26504039 Up-regulation of ATF4 is associated with Pancreatic Neuroendocrine Tumors.
26239904 TBL2 participates in ATF4 translation through its association with the mRNA.
26172539 a reduction of cell death was associated with decreased levels of ATF4 in a rhabdomyosarcoma cell line
26125799 Combined administration inhibited the cells most potently and time-dependently, decreased the expression of HO-1, and significantly increased the expression of ATF4, CHOP, and Ire-1 proteins expression levels
26111340 Global profiling in human mesenchymal stem cells and a novel cell-free assay reveals that ATF4 requires C/EBPbeta for genomic binding at a motif distinct from that bound by the C/EBPbeta homodimer.
26030745 This study outlines the mechanism of NIR laser phototoxicity and the utility of monitoring surface temperature and ATF4 expression as potential biomarkers to develop safe and effective clinical applications.
26011642 Upon loss of attachment in tumor cells, ATF4 activated a program of cytoprotective autophagy and antioxidant responses, including induced expression of heme oxygenase 1 (HO-1). Increased levels of HO-1 ameliorated oxidative stress and cell death.
25931127 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
25795775 RET as a novel dual kinase with nuclear localization and provide mechanisms by which RET represses the proapoptotic genes
25727012 ATF4 signaling pathway is essential for mediating the effect of ER stress on beta-klotho expression.
25633195 Authors observed that a slow rate of ATF4-translation and late re-initiation of general translation coincided with cells which were resistant to ER stress-induced cell death.
25567807 The results demonstrate that the endoplasmic reticulum stress-regulated ATF4/p16 pathway is involved in the premature senescence of renal tubular epithelial cells during diabetic nephropathy progression.
25449779 High ATF4 expression is associated with trastuzumab-resistant breast cancer.
25375376 A sustained deficiency of mitochondrial respiratory complex III induces an apoptotic cell death through the p53-mediated inhibition of pro-survival activities of the ATF4.
25236743 Treatment with a skin sensitizer rapidly induces the phosphorylation of eIF2a and a concomitant increase of ATF4 protein levels in dendritic cells.
25171414 These results reveal an active role for intra-axonal translation in neurodegeneration and identify ATF4 as a mediator for the spread of Alzheimer's disease pathology.
25142020 ASCT2 expression, which correlates with that of N-Myc and ATF4, is markedly elevated in high-stage neuroblastoma
25130172 ATF4 may promote multidrug resistance in esophageal squamous cell carcinoma cells through the up-regulation of STAT3 expression
25078779 ATF4 is a potential biomarker for esophageal squamous cell carcinoma (ESCC) prognosis and its dysregulation may play a key role in the regulation of invasion and metastasis in ESCC.
25052841 ATF4-mediated repression of apelin contributes substantially to the pro-apoptotic effects of p38.
25002527 Results show that Nrf2 and ATF4 were upregulated by proteasome inhibition and cooperatively enhance human xCT gene expression upon proteasome inhibition.
24905361 The ATF4/p75NTR/IL-8 signal pathway may have an important role in EndoMT induced by SFO.
24874742 Then, activated p38 further enhanced the docking of activating transcription factor 4 (ATF4) onto the CHOP (CCAAT/enhancer-binding protein homologous protein) promoter via eIF2alpha to enhance apoptosis
24853302 Anacardic acid induces HepG2 tumor cell apoptosis associated with ATF4-dependent endoplasmic reticulum stress.
24715035 Bone diseases of diabetes mellitus type 2 showing definite changes of ATP4 gene expression.
24681956 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24418603 ATF4 silencing prevented the activating effect of histidinol and tunicamycin on ATF4 and ALT2 expression. Our findings point to ALT2 as an enzyme involved in the metabolic adaptation of the cell to stress
24330582 Results show that AhR induces VEGF expression in HepG2 cells under glucose deprivation, through a pathway involving ATF4.
24308964 Endoplasmic reticulum stress could promote cell apoptosis through the upregulation of ATF4 levels
24100623 In the current study, authors showed that the NAD(+)-dependent deacetylase, SIRT1, suppresses ATF4 synthesis during proteasome inhibition.
24021586 different species of OxPLs, which are present in the human eye are capable of stimulating expression of VEGF in fetal and primary RPE cells via ATF4-dependent mechanisms.
23975372 These results indicate that increased expression of p-ATF4 (ser 245) may contribute to cancer development of non-small cell lung cancer and may be a potential cancer marker.
23916134 results show that ATF4-regulated SESN2 expression presents a new link between ER stress and mTOR inhibition and autophagy.
23908598 Data indicate that suppressing GCN2 and activating transcription factor 4 (ATF4), expression decreased Amino acid deprivation (AAD)-induced VEGF expression.
23891064 Lower expression of ATF4 and VEGF genes in chorionic villus tissue may participate in the pathogenesis of spontaneous abortion.
23792164 Upregulated ATF4 results in the transcriptional initiation of the apoptosis-related chop gene and autophagy-related map1lc3b gene, through which selenite links ER stress to apoptosis and autophagy during leukemia treatment
23471465 This study demonstrates a molecular "field of injury " throughout the bronchial airway of active and former smokers with COPD that may be driven in part by ARF4.
23392669 ATF4 plays a protective role in Parkinson's disease through the regulation of parkin.
23339444 Signaling dynamics of palmitate-induced ER stress responses mediated by ATF4 in HepG2 cells.
23294542 the PERK/ATF4/LAMP3-arm of the UPR is an additional pathway mediating hypoxia-induced breast cancer cell migration
23242184 Identification of a novel ATF4 binding site within the EPO 3'-enhancer region, suggests a distinct role for ATF4 in the unfolded protein response-dependent suppression of the enhancer.
23241898 ATF4 acts as a positive regulator in TLR4-triggered cytokine production.
23205607 Overexpression of ATF4 in Caco-2 cells induced increased FGF19 mRNA expression, whereas shRNA (short hairpin RNA)-mediated depletion of ATF4
23153536 Glutamine depletion in MYC-transformed cells induces apoptosis through ATF4-dependent, but p53-independent, PUMA and NOXA induction.
23090478 The BH3-only protein harakiri (HRK) is transactivated by ATF4 in severe hypoxia through direct binding of ATF4 to the promoter region.
23078367 Data show that the autophagy-initiating kinase ULK1 (UNC51-like kinase 1) is a direct transcriptional target of ATF4 (activating transcription factor 4), which drives the expression of ULK1 mRNA and protein in severe hypoxia and ER stress.
23001845 ATF4 inhibit DNA repair protein DNA-dependent protein kinase 1 induced by heat shock
22955275 ATF4-dependent regulation of the JMJD3 gene during amino acid deprivation can be rescued in Atf4-deficient cells by inhibition of deacetylation.
22915762 results show that the PERK/ATF4 arm of UPR mediates the angiogenic switch and is a potential target for antiangiogenic cancer therapy.
22848420 glucose deprivation enhanced F7 expression in a mechanism reliant on prior ATF4 upregulation primarily due to increased transcription from the ATF4 gene.
22813743 PERK plays a critical role in information processing and cognitive function and that modulation of eIF2alpha phosphorylation and ATF4 expression.
22691366 ATF4 and Nrf2 can control CHOP induction in thyroid cancer cells by proteasome inhibition.
22609407 ATF4 is involved in ER stress signalling through the AARE, which further supports our finding that CK2 inhibition provokes an amino acid induced response pathway.
22485215 Opposite changes in the expression of ATF-3 and ATF-4 genes in atherosclerotic and psoriatic samples were revealed and a hypothesis was put forward that this parameter could be a criterion of pathological process in both diseases.
22435535 Changes in the bioenergetic function of mitochondria are mimicked by activation of AMP kinase and silencing of ATF4.
22422769 Data show that Disrupted-In-Schizophrenia 1 (DISC1) interacts with the transcription factor activating transcription factor 4 (ATF4) in the nucleus, and the common variant 607F additionally reduces DISC1/ATF4 interaction.
22363646 ATF4 facilitated multidrug resistance in gastric cancer cells through direct binding to the SIRT1 promoter.
22338651 ATF4 increases resistance to cisplatin in the hepatocellular carcinoma by increased biosynthesis of glutathione
22246806 Saturated fatty acid-induced ER stress and apoptosis in these human liver cells were enacted through the PERK/ATF4/CHOP signaling pathway.
22233381 These results add FGF21 gene induction to the transcriptional programme initiated by increased levels of ATF4 and offer a new mechanism for the induction of the FGF21 gene expression under nutrient deprivation
22082360 [review] First evidence of a functional interaction between ATF4, FIAT (factor-inhibiting ATF4-mediated transcription) and alphaNAC (nascent polypeptide-associated complex and coactivator alpha).
22052162 elevated expression of p-CREB-2 (ser 245) may potentially contribute to carcinogenesis and cancer development of breast carcinoma
22050711 These results show for the first time that ATF4 induction might have an important role in HIV replication, and suggest that ATF4 might represent a convergent signaling molecule for different stressors important in regulating the HIV-1 cycle.
22050711 HIV-1 infection-mediated upregulation of ATF4 enhances HIV replication by synergistic interaction with HIV Tat
22016052 HHV-8 upregulates ATF4 expression and induces MCP-1 production and proangiogenic properties in endothelial cells.
22007000 Data show that signaling via the androgen receptor and ATF4 pathways regulates expression of the amino acid transporters LAT1 and LAT3, thereby coordinating their increased expression in prostate cancer cells.
21966512 ATF4 protein binds and activates the AARE regulatory sites of the CHOP promoter. ORF2 expression also leads to increased phosphorylation of eIF2alpha that in turn initiates the translation of ATF4 mRNA.
21951999 Coexistence of PHD1 stabilized ATF4, as opposed to the destabilization of ATF4 by PHD3.
21866569 Twist1 overexpression in osteoblasts attenuates ATF4 binding to the osteocalcin promoter in response to Parathyroid hormone.
21801305 Salermide induces expression of ATF4, and ATF4 up-regulates ATF3 and subsequently modulates CHOP which leads to apoptosis in human cancer cells.
21706477 we show that RPL41 induces ATF4 phosphorylation and rapid degradation in the proteasome
21683813 DKK1 is a novel target gene in the response to amino acid deficiency and that the expression of DKK1 is up-regulated through an ATF4-independent and an ERK-dependent pathway.
21244365 ATF4 binding to the COX2 promoter plays a critical role in HBx-mediated COX2 induction.
21203563 the GCN2/eIF2alpha/ATF4 pathway is essential for the induction of the TRB3 gene transcription
21113145 stress-induced upregulation of parkin is mediated by activating transcription factor 4
21087962 These results suggest that the stress induction of ATF4 is significantly regulated transcriptionally through a Nrf2-dependent mechanism
21044953 small molecules such as celecoxib induce DR5 expression through activating ERK/RSK signaling and subsequent Elk1 activation and ATF4-dependent CHOP induction
20732869 Stress conditions such as endoplasmic reticulum stress induce both transcription and translation of ATF4, which together enhance expression of ATF4 and its target genes in response to eIF2 approximately P.
20724472 precise regulation of the ATF4 dosage impacts cell cycle control and impinges on neurogenesis.
20592469 The pseudokinase tribbles homolog 3 interacts with ATF4 to negatively regulate insulin exocytosis in human and mouse beta cells.
20564243 The stimulation of p38 MAPK by DDR2 was required for DDR2-induced activation of Runx2 and OCN promoters.
20551969 GCN2 and its downstream target, the transcriptional activator ATF4, is critical for proliferation and survival of tumour cells after starvation for amino acids or glucose and is essential for growth in vivo in a xenograft model.
20514020 ATF4 has a key role in the regulation of autophagy in response to ER stress and is a direct link between endoplasmic stress response and autophagic machinery.
20473272 The authors conclude that the GCN2-eIF2alpha-ATF4 pathway is critical for maintaining metabolic homeostasis in tumour cells, making it a novel and attractive target for anti-tumour approaches.
20185790 Oxidized phospholipids induce an angiogenic switch in endothelial cells at least partially acting via a cross-talk between NRF2 and ATF4, thus leading to induction of VEGF.
20022965 ATF4 mediates ER stress-induced cell death of neuroectodermal tumor cells in response to fenretinide or bortezomib
19946894 Nuclear protein 1 induced by ATF4 in response to various stressors acts as a positive regulator on the transcriptional activation of ATF4
19855386 TRIF-mediated signals from toll-like receptors selectively attenuate translational activation of ATF4 and its downstream target gene CHOP.
19509279 ATF4 alone is sufficient to trigger an amino acid-responsive transcriptional control program
19453261 Observational study of gene-disease association. (HuGE Navigator)
19417138 Induction of autophagy through ATF4 may be an important resistance mechanism to Bortezomib treatment in breast cancer, and targeting autophagy may represent a novel approach to sensitize breast cancers to Bortezomib.
19251251 Observational study of gene-disease association. (HuGE Navigator)
19193809 In infection, pUL38 allowed HCMV to upregulate phosphorylation of PKR-like ER kinase (PERK) and the alpha subunit of eukaryotic initiation factor 2 (eIF-2alpha), as well as induce robust accumulation of activating transcriptional factor 4 (ATF4).
19114033 The results suggest that REDD1 expression is upregulated during ER stress through a mechanism involving activation of PERK, phosphorylation of eIF2alpha, and increased ATF4 expression.
19073601 celecoxib up-regulates the expression of S100P through an ATF4-mediated endoplasmic reticulum stress response
19017641 ATF4 and phospho-eIF2alpha levels are tightly correlated and up-regulated in Alzheimer disease
18940792 CHOP is a member of the transcription factor network that controls the stress-induced regulation of specific C/EBP-ATF4-containing genes, such as ASNS
18697751 Despite increased ATF4 binding at the C/EBP-ATF composite site following activation of the unfolded protein response, system A transporter 2 (SNAT2) transcription activity is repressed
18635891 Compared with COPD and donor lungs, protein levels of ER stress mediators, such as ATF-6 and ATF-4 and the apoptosis-inductor CHOP as well as XBP-1, were significantly elevated in lung homogenates and AECIIs of IPF lungs
18451308 characterize unfolded protein response ATF4 branch as an important mechanism mediating up-regulation of VEGF by OxPLs
18408768 Multiple pathways are involved in the anoxia response of SKIP3 including HuR-regulated RNA stability, NF-kappaB and ATF4
18195013 ATF4 contributes to basal ATF5 transcription, and eIF2 kinases direct the translational expression of multiple transcription regulators by a mechanism involving delayed translation reinitiation
18189280 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18171674 TFIIA gamma together with ATF4 and Runx2 stimulates osteocalcin promoter activity and endogenous mRNA expression.
18163433 ATF4 gene may be involved in susceptibility to schizophrenia with sex-dependent effect.
18163433 Observational study of gene-disease association. (HuGE Navigator)
17996332 23P-ATF4 peptide fits the binding pocket of protein beta-TrCP very well, considering that the DpSGIXXpSXE motif adopts an S-turning conformation contrary to the extended DpSGXXpS motif in the other known beta-TrCP ligands.
17938202 The ATF4-mediated up-regulation of Ape1 and other genes plays a key role against arsenite-mediated toxicity and mutagenesis.
17822787 overexpression of either CREB or ATF4 enhanced the activation of the HEC1 promoter and overexpression of both of them had an additive effect on the activation of the HEC1 transcription.
17707795 The results indicate that TRB3 protects cells against the growth inhibitory and cytotoxic effect of ATF4.
17684156 PHD-dependent oxygen-sensing recruits both the hypoxia-inducible factor (HIF) and ATF-4 systems.
17369260 TRB3 and ATF4 belong to the same protein complex bound to the sequence involved in the ATF4-dependent regulation of gene expression by amino acid limitation.
17347301 ATF4 may regulate myeloid gene expression differentially by potentiating C/EBPepsilon but inhibiting C/EBPalpha-mediated transcriptional activation.
17346882 Observational study of gene-disease association. (HuGE Navigator)
17346882 Contribution of common variations of ATF4 and ATF5 to the pathophysiology of bipolar disorder may be minimal if any.
16687408 Endoplasmic reticulum stress induction of IGFBP-1 involves ATF4
16682973 activation by nephrocystin-6 in Joubert syndrome
16219772 both p300 and CBP increase ATF4 transcriptional activity
15677469 Results suggest that mitosin is a negative regulator of ATF4 in interphase through direct interaction.
15385533 ATF3-FL and C/EBPbeta act as transcriptional suppressors for the ASNS gene to counterbalance the transcription rate activated by ATF4 following amino acid deprivation
15314157 Data demonstrate the essential role of activating transcription factor 4 (ATF4) in the response to hypoxic stress, and reveal that GADD34, a target of ATF4 activation, negatively regulates the eIF2alpha-mediated inhibition of translation.
14747470 ATF4 has a role in regulating VEGF expression
14695168 Expression of ATF4 was found to correlate with cisplatin sensitivity in human cancer cell lines.
14630918 ATF4 and ATF2 have roles in regulating CHOP expression
14561767 HIV-1 infection-mediated upregulation of ATF4 enhances HIV replication by synergistic interaction with HIV Tat
12860379 interaction between RPB3 and ATF4
11960987 mediator of the nutrient-sensing response pathway that activates the asparagine synthetase gene

AA Sequence

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSP      1 - 70
SNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNP     71 - 140
IGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKE    141 - 210
EDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDK    211 - 280
KLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRV    281 - 350
P//

Text Mined References (180)

PMID Year Title
26884600 2016 ONC201 kills solid tumor cells by triggering an integrated stress response dependent on ATF4 activation by specific eIF2? kinases.
26771712 2016 Mitochondrial dysfunction induces SESN2 gene expression through Activating Transcription Factor 4.
26648175 2016 Placental endoplasmic reticulum stress negatively regulates transcription of placental growth factor via ATF4 and ATF6?: implications for the pathophysiology of human pregnancy complications.
26504039 2015 Endoplasmic Reticulum Stress in Pancreatic Neuroendocrine Tumors is Linked to Clinicopathological Parameters and Possible Epigenetic Regulations.
26239904 2016 TBL2 Associates With ATF4 mRNA Via Its WD40 Domain and Regulates Its Translation During ER Stress.
26172539 2015 ATF4 mediates necrosis induced by glucose deprivation and apoptosis induced by 2-deoxyglucose in the same cells.
26125799 2015 Proapoptotic effects of heme oxygenase-1 inhibitor on Kasumi-1 cells via the ATF4/CHOP/Ire-1? pathway.
26111340 2015 ATF4 licenses C/EBP? activity in human mesenchymal stem cells primed for adipogenesis.
26086088 2015 Transcription Factor ATF4 Induces NLRP1 Inflammasome Expression during Endoplasmic Reticulum Stress.
26030745 2015 Molecular pathway of near-infrared laser phototoxicity involves ATF-4 orchestrated ER stress.
26011642 2015 ATF4-dependent induction of heme oxygenase 1 prevents anoikis and promotes metastasis.
25931127 2015 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
25795775 2015 A novel dual kinase function of the RET proto-oncogene negatively regulates activating transcription factor 4-mediated apoptosis.
25727012 2015 Endoplasmic reticulum stress induces up-regulation of hepatic ?-Klotho expression through ATF4 signaling pathway.
25681212 Loss of lysosome-associated membrane protein 3 (LAMP3) enhances cellular vulnerability against proteasomal inhibition.
25633195 2015 Imaging of single cell responses to ER stress indicates that the relative dynamics of IRE1/XBP1 and PERK/ATF4 signalling rather than a switch between signalling branches determine cell survival.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25567807 2015 Impact of ER stress-regulated ATF4/p16 signaling on the premature senescence of renal tubular epithelial cells in diabetic nephropathy.
25449779 2015 A pathway-based approach for identifying biomarkers of tumor progression to trastuzumab-resistant breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25375376 2014 A sustained deficiency of mitochondrial respiratory complex III induces an apoptotic cell death through the p53-mediated inhibition of pro-survival activities of the activating transcription factor 4.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25236743 2014 Oxidative stress-dependent activation of the eIF2?–ATF4 unfolded protein response branch by skin sensitizer 1-fluoro-2,4-dinitrobenzene modulates dendritic-like cell maturation and inflammatory status in a biphasic manner [corrected].
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25171414 2014 Axonally synthesized ATF4 transmits a neurodegenerative signal across brain regions.
25142020 2015 ATF4 and N-Myc coordinate glutamine metabolism in MYCN-amplified neuroblastoma cells through ASCT2 activation.
25130172 2014 Activating transcription factor 4 mediates a multidrug resistance phenotype of esophageal squamous cell carcinoma cells through transactivation of STAT3 expression.
25078779 2014 Activating transcription factor 4 promotes esophageal squamous cell carcinoma invasion and metastasis in mice and is associated with poor prognosis in human patients.
25052841 2014 Apelin is transcriptionally regulated by ER stress-induced ATF4 expression via a p38 MAPK-dependent pathway.
25002527 2014 Nrf2- and ATF4-dependent upregulation of xCT modulates the sensitivity of T24 bladder carcinoma cells to proteasome inhibition.
24939851 2014 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib.
24905361 2014 Finding ATF4/p75NTR/IL-8 signal pathway in endothelial-mesenchymal transition by safrole oxide.
24874742 2014 Involvement of p38 in signal switching from autophagy to apoptosis via the PERK/eIF2?/ATF4 axis in selenite-treated NB4 cells.
24853302 2014 Anacardic acid induces cell apoptosis associated with induction of ATF4-dependent endoplasmic reticulum stress.
24715035 2014 Gene expression changes in cancellous bone of type 2 diabetics: a biomolecular basis for diabetic bone disease.
24681956 2015 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24418603 2014 Activating transcription factor 4 mediates up-regulation of alanine aminotransferase 2 gene expression under metabolic stress.
24330582 2013 An aryl hydrocarbon receptor induces VEGF expression through ATF4 under glucose deprivation in HepG2.
24308964 2014 HDAC4 protects cells from ER stress induced apoptosis through interaction with ATF4.
24100623 2013 SIRT1 suppresses activating transcription factor 4 (ATF4) expression in response to proteasome inhibition.
24021586 2013 Retinal pigment epithelium cells produce VEGF in response to oxidized phospholipids through mechanisms involving ATF4 and protein kinase CK2.
23975372 2014 Expression of a phosphorylated form of ATF4 in lung and non-small cell lung cancer tissues.
23916134 2013 Nelfinavir and bortezomib inhibit mTOR activity via ATF4-mediated sestrin-2 regulation.
23908598 2013 Amino acid deprivation promotes tumor angiogenesis through the GCN2/ATF4 pathway.
23891064 2013 Expression of ATF4 and VEGF in chorionic villus tissue in early spontaneous abortion.
23792164 2013 ATF4 activation by the p38MAPK-eIF4E axis mediates apoptosis and autophagy induced by selenite in Jurkat cells.
23665047 2013 Internal ribosome entry site-mediated translational regulation of ATF4 splice variant in mammalian unfolded protein response.
23471465 2013 A dynamic bronchial airway gene expression signature of chronic obstructive pulmonary disease and lung function impairment.
23392669 2013 ATF4 protects against neuronal death in cellular Parkinson's disease models by maintaining levels of parkin.
23339444 2013 Signaling dynamics of palmitate-induced ER stress responses mediated by ATF4 in HepG2 cells.
23294542 2013 Hypoxia stimulates migration of breast cancer cells via the PERK/ATF4/LAMP3-arm of the unfolded protein response.
23242184 2013 Endoplasmic reticulum stress signal impairs erythropoietin production: a role for ATF4.
23241898 2013 ATF4 is directly recruited by TLR4 signaling and positively regulates TLR4-trigged cytokine production in human monocytes.
23205607 2013 FGF19 (fibroblast growth factor 19) as a novel target gene for activating transcription factor 4 in response to endoplasmic reticulum stress.
23153536 2012 ATF4 regulates MYC-mediated neuroblastoma cell death upon glutamine deprivation.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23090478 2012 ATF4 orchestrates a program of BH3-only protein expression in severe hypoxia.
23078367 2013 Transcriptional up-regulation of ULK1 by ATF4 contributes to cancer cell survival.
23001845 2012 ATF4 and IRE1? inhibit DNA repair protein DNA-dependent protein kinase 1 induced by heat shock.
22974638 2012 ATF4 interacts with Abro1/KIAA0157 scaffold protein and participates in a cytoprotective pathway.
22955275 2012 ATF4-dependent regulation of the JMJD3 gene during amino acid deprivation can be rescued in Atf4-deficient cells by inhibition of deacetylation.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
22915762 2012 The unfolded protein response induces the angiogenic switch in human tumor cells through the PERK/ATF4 pathway.
22848420 2012 Upregulation of the coagulation factor VII gene during glucose deprivation is mediated by activating transcription factor 4.
22813743 2012 Brain-specific disruption of the eIF2? kinase PERK decreases ATF4 expression and impairs behavioral flexibility.
22691366 2012 Implication of Nrf2 and ATF4 in differential induction of CHOP by proteasome inhibition in thyroid cancer cells.
22609407 2012 CK2 regulates ATF4 and CHOP transcription within the cellular stress response signalling pathway.
22485215 2011 Comparative study of the expression of ATF-3 and ATF-4 genes in vessels involved into atherosclerosis process and in psoriatic skin.
22435535 2012 AMPK and GCN2-ATF4 signal the repression of mitochondria in colon cancer cells.
22422769 2012 DISC1 variants 37W and 607F disrupt its nuclear targeting and regulatory role in ATF4-mediated transcription.
22363646 2012 Activating transcription factor 4 confers a multidrug resistance phenotype to gastric cancer cells through transactivation of SIRT1 expression.
22338651 2012 Activating transcription factor 4 increases chemotherapeutics resistance of human hepatocellular carcinoma.
22246806 2012 Saturated fatty acid induction of endoplasmic reticulum stress and apoptosis in human liver cells via the PERK/ATF4/CHOP signaling pathway.
22233381 2012 Activating transcription factor 4-dependent induction of FGF21 during amino acid deprivation.
22082360 2011 Combinatorial control of ATF4-dependent gene transcription in osteoblasts.
22052162 2012 Elevated p-CREB-2 (ser 245) expression is potentially associated with carcinogenesis and development of breast carcinoma.
22050711 2012 Short communication: activating transcription factor 4 (ATF4) promotes HIV type 1 activation.
22016052 2012 Activating transcription factor 4 (ATF4) is upregulated by human herpesvirus 8 infection, increases virus replication and promotes proangiogenic properties.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
22007000 2011 Androgen receptor and nutrient signaling pathways coordinate the demand for increased amino acid transport during prostate cancer progression.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21966512 2011 Hepatitis E virus ORF2 protein activates the pro-apoptotic gene CHOP and anti-apoptotic heat shock proteins.
21951999 2011 PHD1 interacts with ATF4 and negatively regulates its transcriptional activity without prolyl hydroxylation.
21866569 2012 The basic helix loop helix transcription factor Twist1 is a novel regulator of ATF4 in osteoblasts.
21801305 2012 Salermide up-regulates death receptor 5 expression through the ATF4-ATF3-CHOP axis and leads to apoptosis in human cancer cells.
21706477 2011 Ribosomal protein RPL41 induces rapid degradation of ATF4, a transcription factor critical for tumour cell survival in stress.
21683813 2011 Dickkopf homolog 1, a Wnt signaling antagonist, is transcriptionally up-regulated via an ATF4-independent and MAPK/ERK-dependent pathway following amino acid deprivation.
21408167 2011 New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.
21244365 2011 Endoplasmic reticulum stress induced by hepatitis B virus X protein enhances cyclo-oxygenase 2 expression via activating transcription factor 4.
21203563 2010 Amino acid availability controls TRB3 transcription in liver through the GCN2/eIF2?/ATF4 pathway.
21113145 2011 Parkin is transcriptionally regulated by ATF4: evidence for an interconnection between mitochondrial stress and ER stress.
21087962 2011 Transcriptional regulation of activating transcription factor 4 under oxidative stress in retinal pigment epithelial ARPE-19/HPV-16 cells.
21044953 2010 ERK/ribosomal S6 kinase (RSK) signaling positively regulates death receptor 5 expression through co-activation of CHOP and Elk1.
20936779 2010 A human MAP kinase interactome.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
20732869 2010 Both transcriptional regulation and translational control of ATF4 are central to the integrated stress response.
20724472 2010 Control of activating transcription factor 4 (ATF4) persistence by multisite phosphorylation impacts cell cycle progression and neurogenesis.
20592469 2010 The pseudokinase tribbles homolog 3 interacts with ATF4 to negatively regulate insulin exocytosis in human and mouse beta cells.
20564243 2010 Transcriptional upregulation of DDR2 by ATF4 facilitates osteoblastic differentiation through p38 MAPK-mediated Runx2 activation.
20551969 2010 How do tumours adapt to nutrient stress?
20514020 2010 Regulation of autophagy by ATF4 in response to severe hypoxia.
20473272 2010 The GCN2-ATF4 pathway is critical for tumour cell survival and proliferation in response to nutrient deprivation.
20185790 2010 Oxidized phospholipids regulate expression of ATF4 and VEGF in endothelial cells via NRF2-dependent mechanism: novel point of convergence between electrophilic and unfolded protein stress pathways.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20022965 2010 Regulation of endoplasmic reticulum stress-induced cell death by ATF4 in neuroectodermal tumor cells.
19946894 2009 Nuclear protein 1 induced by ATF4 in response to various stressors acts as a positive regulator on the transcriptional activation of ATF4.
19855386 2009 Adaptive suppression of the ATF4-CHOP branch of the unfolded protein response by toll-like receptor signalling.
19509279 2009 Elevated ATF4 expression, in the absence of other signals, is sufficient for transcriptional induction via CCAAT enhancer-binding protein-activating transcription factor response elements.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19417138 2009 The role of ATF4 stabilization and autophagy in resistance of breast cancer cells treated with Bortezomib.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
19193809 2009 Human cytomegalovirus protein pUL38 induces ATF4 expression, inhibits persistent JNK phosphorylation, and suppresses endoplasmic reticulum stress-induced cell death.
19114033 2009 ATF4 is necessary and sufficient for ER stress-induced upregulation of REDD1 expression.
19073601 2009 Up-regulation of S100P expression by non-steroidal anti-inflammatory drugs and its role in anti-tumorigenic effects.
19061639 2008 Role of SERCA1 truncated isoform in the proapoptotic calcium transfer from ER to mitochondria during ER stress.
19017641 2009 Basal levels of eIF2alpha phosphorylation determine cellular antioxidant status by regulating ATF4 and xCT expression.
18940792 2008 C/EBP homology protein (CHOP) interacts with activating transcription factor 4 (ATF4) and negatively regulates the stress-dependent induction of the asparagine synthetase gene.
18697751 2008 Despite increased ATF4 binding at the C/EBP-ATF composite site following activation of the unfolded protein response, system A transporter 2 (SNAT2) transcription activity is repressed in HepG2 cells.
18635891 2008 Epithelial endoplasmic reticulum stress and apoptosis in sporadic idiopathic pulmonary fibrosis.
18451308 2008 ATF4-dependent transcription is a key mechanism in VEGF up-regulation by oxidized phospholipids: critical role of oxidized sn-2 residues in activation of unfolded protein response.
18408768 2008 Multiple pathways are involved in the anoxia response of SKIP3 including HuR-regulated RNA stability, NF-kappaB and ATF4.
18195013 2008 Phosphorylation of eIF2 directs ATF5 translational control in response to diverse stress conditions.
18189280 2008 Lithium response and genetic variation in the CREB family of genes.
18171674 2008 General transcription factor IIA-gamma increases osteoblast-specific osteocalcin gene expression via activating transcription factor 4 and runt-related transcription factor 2.
18163433 2008 Associations of ATF4 gene polymorphisms with schizophrenia in male patients.
17996332 2007 Phosphorylation-dependent structure of ATF4 peptides derived from a human ATF4 protein, a member of the family of transcription factors.
17938202 2007 ATF4-dependent oxidative induction of the DNA repair enzyme Ape1 counteracts arsenite cytotoxicity and suppresses arsenite-mediated mutagenesis.
17822787 Functional characterization of the promoter of human kinetochore protein HEC1: novel link between regulation of the cell cycle protein and CREB family transcription factors.
17707795 2007 TRB3 protects cells against the growth inhibitory and cytotoxic effect of ATF4.
17684156 2007 Oxygen-dependent ATF-4 stability is mediated by the PHD3 oxygen sensor.
17369260 2007 TRB3 inhibits the transcriptional activation of stress-regulated genes by a negative feedback on the ATF4 pathway.
17347301 2007 ATF4 differentially regulates transcriptional activation of myeloid-specific genes by C/EBPepsilon and C/EBPalpha.
17346882 2007 Association analysis of ATF4 and ATF5, genes for interacting-proteins of DISC1, in bipolar disorder.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16687408 2006 Endoplasmic reticulum stress induction of insulin-like growth factor-binding protein-1 involves ATF4.
16682973 2006 The centrosomal protein nephrocystin-6 is mutated in Joubert syndrome and activates transcription factor ATF4.
16343488 2006 Cooperative interaction of Zhangfei and ATF4 in transactivation of the cyclic AMP response element.
16219772 2005 p300 modulates ATF4 stability and transcriptional activity independently of its acetyltransferase domain.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15911876 2005 FIAT represses ATF4-mediated transcription to regulate bone mass in transgenic mice.
15788408 2005 The oxidative stressor arsenite activates vascular endothelial growth factor mRNA transcription by an ATF4-dependent mechanism.
15775988 2005 TRB3, a novel ER stress-inducible gene, is induced via ATF4-CHOP pathway and is involved in cell death.
15677469 2005 Mitosin/CENP-F as a negative regulator of activating transcription factor-4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15385533 2004 Amino acid deprivation induces the transcription rate of the human asparagine synthetase gene through a timed program of expression and promoter binding of nutrient-responsive basic region/leucine zipper transcription factors as well as localized histone acetylation.
15314157 2004 Activating transcription factor 4 is translationally regulated by hypoxic stress.
15277680 2004 Reinitiation involving upstream ORFs regulates ATF4 mRNA translation in mammalian cells.
14747470 2004 Homocysteine increases the expression of vascular endothelial growth factor by a mechanism involving endoplasmic reticulum stress and transcription factor ATF4.
14695168 2003 Activating transcription factor 4 increases the cisplatin resistance of human cancer cell lines.
14685163 2004 Roles of CHOP/GADD153 in endoplasmic reticulum stress.
14630918 2004 Induction of CHOP expression by amino acid limitation requires both ATF4 expression and ATF2 phosphorylation.
14561767 2004 HIV-1 Vpu sequesters beta-transducin repeat-containing protein (betaTrCP) in the cytoplasm and provokes the accumulation of beta-catenin and other SCFbetaTrCP substrates.
12871976 2003 Induction of Grp78/BiP by translational block: activation of the Grp78 promoter by ATF4 through and upstream ATF/CRE site independent of the endoplasmic reticulum stress elements.
12860379 2003 Functional interaction of the subunit 3 of RNA polymerase II (RPB3) with transcription factor-4 (ATF4).
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12743605 2003 SKIP3, a novel Drosophila tribbles ortholog, is overexpressed in human tumors and is regulated by hypoxia.
12689582 2003 All roads lead to ATF4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11960987 2002 ATF4 is a mediator of the nutrient-sensing response pathway that activates the human asparagine synthetase gene.
11478948 2001 The cAMP response element binding protein-2 (CREB-2) can interact with the C/EBP-homologous protein (CHOP).
11274184 2001 Identification of activating transcription factor 4 (ATF4) as an Nrf2-interacting protein. Implication for heme oxygenase-1 gene regulation.
11238952 2001 ATF4 degradation relies on a phosphorylation-dependent interaction with the SCF(betaTrCP) ubiquitin ligase.
11087824 2000 The GABAB receptor interacts directly with the related transcription factors CREB2 and ATFx.
11025215 2000 Expression of the bZIP transcription factor TCF11 and its potential dimerization partners during development.
11018027 2001 Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA.
10591208 1999 The DNA sequence of human chromosome 22.
10419887 1999 Homocysteine-induced endoplasmic reticulum stress and growth arrest leads to specific changes in gene expression in human vascular endothelial cells.
9488481 1998 ZIP kinase, a novel serine/threonine kinase which mediates apoptosis.
9295363 1997 Characterization of human activating transcription factor 4, a transcriptional activator that interacts with multiple domains of cAMP-responsive element-binding protein (CREB)-binding protein.
9190894 1997 Functional interaction of the HTLV-1 transactivator Tax with activating transcription factor-4 (ATF4).
8939898 1996 Homocysteine-respondent genes in vascular endothelial cells identified by differential display analysis. GRP78/BiP and novel genes.
2516827 1989 Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.
1847461 1991 Isolation of cDNAs for DNA-binding proteins which specifically bind to a tax-responsive enhancer element in the long terminal repeat of human T-cell leukemia virus type I.
1827203 1991 Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity.
1534408 1992 Molecular cloning of human CREB-2: an ATF/CREB transcription factor that can negatively regulate transcription from the cAMP response element.
1371974 1992 cDNA clones encoding leucine-zipper proteins which interact with G-CSF gene promoter element 1-binding protein.