Property Summary

NCBI Gene PubMed Count 163
PubMed Score 465.83
PubTator Score 256.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2346 4.17 2.1
Neuropathy 210 3.276 1.6
Vascular disease 281 3.136 1.6

Expression

  Differential Expression (31)

Disease log2 FC p
nephrosclerosis -2.069 1.8e-04
gastric carcinoma 2.700 4.0e-02
hepatocellular carcinoma -1.300 1.1e-03
Multiple myeloma 1.925 2.1e-02
urothelial carcinoma -3.200 9.1e-04
malignant mesothelioma 3.100 3.1e-08
esophageal adenocarcinoma 1.900 4.2e-02
glioblastoma 2.800 3.3e-03
osteosarcoma 1.500 1.0e-02
cystic fibrosis -1.646 2.2e-06
adrenocortical carcinoma -1.987 2.9e-03
tuberculosis and treatment for 3 months -1.500 8.9e-04
non-small cell lung cancer -1.912 4.9e-12
lung cancer -4.300 1.8e-07
interstitial cystitis 1.700 1.5e-03
group 4 medulloblastoma -2.000 2.3e-03
posterior fossa group A ependymoma 1.500 3.4e-03
aldosterone-producing adenoma -1.344 2.2e-02
invasive ductal carcinoma -1.240 1.8e-02
lung adenocarcinoma -1.719 1.8e-04
psoriasis -3.300 4.3e-14
inflammatory breast cancer -4.200 1.5e-06
lung carcinoma -1.600 1.3e-06
breast carcinoma -1.400 6.0e-12
pterygium -2.300 3.9e-02
Bipolar Disorder 1.297 8.0e-03
acute myeloid leukemia 1.400 1.0e-02
ulcerative colitis 2.100 1.3e-02
ovarian cancer 2.900 2.5e-04
pituitary cancer -2.900 5.3e-05
chronic rhinosinusitis -1.808 1.0e-02

 IMPC Phenotype (1)

Gene RIF (135)

PMID Text
26994140 As a result, ATF3 rather protected the p53 wild-type cells from UV-induced apoptosis. Our results thus indicate that ATF3 regulates cell fates upon UV irradiation in a p53-dependent manner.
26851004 ATF3 overexpression leads to an increase of collective cell invasion phenotype in Colorectal Cancer.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26709509 TGRL lipolysis products induce stress protein ATF3 via the TGF-beta receptor pathway, resulting in induction of apoptosis in aortic endothelial cells
26418018 Data suggest that after the expression of activating transcription factor 3 (ATF3) and microRNA miR-30c-2-3p elicited by lysophosphatidic acid, miR-30c-2-3p negatively regulates the expression of ATF3 through post-transcriptional silencing.
26412238 Activating transcription factor 3 represses inflammatory responses by binding to the p65 subunit of NF-kappaB
26305977 The function of ATF3 is to block the reactivation of virus induced by neuronal stress.
26051724 Tissue array analysis suggests role for ATF3 in regulating the occurrence of glioma and disease progression.
25931127 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
25872784 Taken together, these results suggest that ATF3 promotes the progression of human gliomas
25865756 The stress-responsive gene ATF3 regulates the histone acetyltransferase Tip60 stability by promoting USP7-mediated deubiquitination of Tip60.
25816118 ATF3 is inactive in healthy hepatic cells and activated following hepatitis C virus infection.
25589515 ATF3 regulates canonical TGFbeta and Smad signaling and fibroblast activation in systemic sclerosis.
25521189 DNA damage-triggered ATF3 controlled p53 accumulation and generation of double-strand breaks may serve as a switch between DNA damage and cell death following TOP2A inhibitor treatment.
25447816 inhibition of cell viability and apoptosis by PCA may be result of ATF3 expression through ERK1/2 and p38-mediated transcriptional activation.
25400120 ATF3 is a downstream target of SRC and CaMKII signaling, and may be involved in adrenocortical aldosterone synthesis.
25380580 ATF-3 was associated with Runx2 promoter in MDA-MB231 cells.
25268131 Urotensin-II induces activating transcription factor 3 (ATF3) at both mRNA and protein levels.
25189785 It compared the induction of ATF3 protein as measured by Western blot analysis with single-molecule localization microscopy dSTORM to quantify the dynamics of accumulation of intranuclear ATF3 of triglyceride-rich (TGRL) lipolysis product-treated HAEC.
25180886 Counterbalance between MIC-1 and ATF3 is critical for deciding the fate of enterocytes under the food chemical stress.
25150595 these results suggest that there is a negative feedback expression of pre-mir-590 and its putative target gene, ATF-3 in human breast cancer cells.
25149542 Suggest critical role for tumor suppressor ATF3 in esophageal squamous cell carcinoma progression.
25122760 superinduced ATF3 attenuated ER stress-induced cancer chemokine expression by epigenetically interfering with induction of EGR-1, a transcriptional modulator crucial to cancer chemokine production.
25096061 in human HCC tissues, SPTBN1 expression correlated negatively with expression levels of STAT3, ATF3, and CREB2; SMAD3 expression correlated negatively with STAT3 expression
25074928 Atf3-silencing reversed ethanol-mediated Gck down-regulation and beta-cell dysfunction, followed by the amelioration of impaired glucose tolerance and insulin resistance.
24939851 results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy
24906227 ATF3 is lower in hepatocellular carcinoma than in hepatic hemangioma. The protein level is lower in patients with capsule invasion, while there is no association with other main clinical pathological features
24859834 show that ATF3 promotes colon cancer metastasis
24742347 HIV-1 and the viral protein Tat modulate the expression of activating transcription factor 3 (ATF3) in immature dendritic cells and monocyte-derived macrophages
24600036 Data indicate that pharmacological or genetic inactivation of PIKfyve rapidly induces expression of the transcription repressor ATF3, which is necessary and sufficient for suppression of type I IFN expression.
24554706 ATF3 can suppress mutp53 oncogenic function, thereby contributing to tumor suppression in TP53-mutated cancer
24509533 We analyzed the influence of UV radiation and cyclosporine A on ATF3 expression and its potential role in squamous cell carcinoma development.
24469490 ATF3 is not highly associated with hypospadias in metropolitan Tokyo. Differences in ethnicity might have influenced our results.
24460316 High ATF3 activates Stat3 phosphorylation through inhibition of p53 expression in skin cancer
24420912 Epithelium-derived exosomal ATF3 RNA attenuates ischemia-reperfusion induced kidney injury by inhibiting MCP-1 gene transcription.
24133584 ATF-3 is involved in the progress of laryngeal squamous cell carcinoma, and may provide clinical information for evaluation of its prognosis. The oncologic role of ATF-3 may be correlated with Cyclin D1 regulation.
24098051 These findings demonstrate that ribosomal stress-induced ATF3 is a critical regulator in the convergent pathways between EGR-1 and NF-kappaB, which contributes to the suppression of Nod2-activated proinflammatory gene expression.
23921126 ATF3 is a regulator in myeloid cells that enhances breast cancer metastasis and has predictive value for clinical outcomes.
23884832 The gene expression profiling results showed that TNFAIP3, ATF3, PPARG are related to osteoarthritis.
23868936 Triglyceride-rich lipoprotein lipolysis products activate ATF3-JNK transcription factor networks and induce endothelial cells inflammatory response.
23733932 In CSB-deficient cells ATF3 remains bound to the promoter, thereby preventing the arrival of polymerase II and the restart of transcription.
23706953 In hippocampal tissue from patients with pharmacoresistant medial temporal lobe epilepsy, we observed an inverse correlation of mrna expression to seizure frequency per month.
23648135 These findings strongly suggest that ATF3 is involved in suppressing IL-6 cytokine expression during gonococcal infection.
23591848 SUMO modification of ATF3 influences CCND1/2 activity and cellular proliferation of prostate cancer PC3 and DU145 cells and explains at least in part how ATF3 functions to regulate cancer development.
23560949 protects against hemin cytotoxicity
23536558 Data indicate that activating transcription factor 3 (ATF3) upregulated actin filament severing protein gelsolin (GSN), whereas ATF3 silencing reduced GSN levels, concomitant with alterations in the actin cytoskeleton.
23269699 Results indicate that both increased cJUN and the cis-acting ATF/CRE sequence within the ATF3 promoter contribute to the transcriptional activation of the gene during the amino acid response (AAR).
23187734 Transcription factor ATF-3 regulates allele variation phenotypes of the human SLC11A1 gene.
23088992 Interaction between genetic and environmnetal factors may explain nonreplication in genetic studies of hypospadias.
23002211 Data indicate that patients with high adenylate kinase-4 (AK4) and low transcription factor ATF3 expression showed unfavorable outcomes compared with patients with low AK4 and high ATF3 expression.
22991139 ATF3 is post-translationally modified by SUMO and SUMOylation of ATF3 plays a functional role in regulation of TP53 gene activity.
22989952 the recruitment of multiple HDAC members to JDP2 and ATF3 is part of their transcription repression mechanism.
22978410 The amino acid response that results in transcriptional activation increases transcription of AFT3 and asparagine synthetase.
22851689 Human ATF3 normalizes fat content and gene expression in atf3 Drosophila melanogaster mutants.
22768301 the role of cholesterol in prostate health, and provide a novel role for ATF3, and associated proteins within a large signaling network, as a cholesterol-sensing mechanism.
22764884 ATF3 expression is a surrogate of malignancy (or pre-malignancy) in keratinocytic epith-elial proliferations and thus helps distinguish squamous cell carcinoma from other cutaneous epithelial neoplasms.
22753726 ATF3 protein expression was up-regulated after cytotoxic doses of cisplatin treatment and it directly bound to the CHOP gene promoter, increasing this pro-apoptotic protein's expression.
22665497 ATF3 is a novel repressor of androgen signaling that can inhibit AR functions, allowing prostate cells to restore homeostasis
22485215 Opposite changes in the expression of ATF-3 and ATF-4 genes in atherosclerotic and psoriatic samples were revealed and a hypothesis was put forward that this parameter could be a criterion of pathological process in both diseases.
22475484 these results demonstrate that ATF3 represses the C/EBPalpha gene, resulting in inhibition of adipocyte differentiation, and thus plays a role in hypoxia-mediated inhibition of adipocyte differentiation.
22179317 the loss of the major reactive oxygen species scavenger, glutathione, during SAIS directly correlates with an increase in the expression of activating transcription factor 3.
22046379 an extensive network of stress-inducible transcription factors and demonstrate that ATF3 has opposing, cell context-dependent effects on p53 target genes in DNA damage response and cancer development
21927023 our results provide a novel insight into the role of ATF3 as an essential co-transcription factor for p53 upon DNA damage
21900211 found that the ability of stromal ATF3 to promote cancer progression is mediated by transcriptional repression of CLDN1 and induction of CXCL12 and RGS4
21821004 these results demonstrate that ATF3 represses PDX-1 expression via binding to an ATF3-responsive element in its promoter, which plays an important role in suppression of pancreatic beta-cells function.
21801305 Salermide induces expression of ATF4, and ATF4 up-regulates ATF3 and subsequently modulates CHOP which leads to apoptosis in human cancer cells.
21467165 MUC18 is involved in cell signaling regulating the expression of Id-1 and ATF-3, thus contributing to melanoma metastasis
21454613 KAI1 gene is engaged in NDRG1 gene-mediated metastasis suppression through the ATF3-NFkappaB complex in human prostate cancer.
21451046 Traumatic axonal injury in transgenic mice induces an early and sustained activation of c-Jun and ATF-3 (activating transcription factor 3), known regulators of axon regeneration.
21421043 ATF3 bound to the TREM-1 promoter.
21414204 ATF3 interacts with HTLV-I bZIP factor and promotes proliferation of ATL cells.
21324310 statistical association between variations in the ATF3 gene and levels of nine serum inflammatory markers, including C reactive protein
21315420 activating transcription factor 3 appears to play an oncogenic role in the development of squamous cell carcinomas and may be related to the biologic behavior of them.
21294679 LDLR repression by organelle stress via ATF3
21191795 displays a unique expression confined to the left heart chambers following acute angiotensin II stimulation
21129190 ATF3 down-regulation in colon cancer promotes tumor growth and metastasis. Blocking Hsp90 induces ATF3 expression.
21061913 ATF3 functions as a "hub" of the cellular adaptive-response network.
20930144 Report demonstrating the ability of ATF3 to enhance breast cancer-initiating cell features and to feedback on TGFbeta.
20696134 ATF3 acts as transcriptional repressor in the regulation of AdiopR1, which may impair adiponectin signaling under obesity and diabetic conditions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20581861 Overexpression of ATF2 resulted in significant increase in ATF3 promoter activity, and electrophoretic mobility shift assay identified this region as a core sequence to which ATF2 binds
20485437 increased ATF3 expression accounts for suppression of p53-dependent senescence and enhanced tumorigenic potential
20423458 The ER stress-induced decrease in both protein and RNA of AdipoR2 results from a concomitant increase in expression of ATF3, which may play a role in the development of obesity-induced insulin resistance and related ER stress in hepatocytes.
20413626 ATF3 as an important early transcriptional regulator of cyclic-stretch-induced responses
20351107 c-Src modulation and ATF3 activity may contribute to differential regulation of IRF-3- versus IRF-5-mediated gene expression
20304822 ATF3 promotes human T helper cell type (Th)1 differentiation and is recruited to and transactivates the interferon-gamma promoter.
20215396 Single nucleotide polymorphisms in ESR2 and ATF3 are borderline associated with hypospadias [odds ratios 0.9 (95% confidence interval 0.7-1.0) and 1.2 (95% confidence interval.
20215396 Observational study of gene-disease association. (HuGE Navigator)
20180416 Estradiol may induce hypospadias by upregulating the expressions of ATF3 and CTGF.
20167600 Activating transcription factor 3 activates p53 by preventing E6-associated protein from binding to E6.
20002170 our findings suggest that ATF3 may play a role in the response of epidermal keratinocytes to inflammatory cytokines.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19582787 TGF-beta1 stimulates expression of activating transcription factor 3 (ATF3) in human breast cancer cells (MDA-MB231).
19219066 Activating Transcription Factor 3 regulates the PCNA-associated factor p15(PAF) protein and required DNA repair of damaged cells.
19136462 In human prostate and Hodgkin Reed-Sternberg cancer cells with elevated expression of ATF3, the P1 promoter was constitutively activated and its chromatin structure was modified into active configuration.
19060337 Chk1 affects Cdc25A via rapid phosphorylation and protein turnover, inhibition of Cdc25A transcription by p53-ATF3 is required for the maintenance of cell cycle arrest.
19050264 HIV-1 and the viral protein Tat modulate the expression of activating transcription factor 3 (ATF3) in immature dendritic cells and monocyte-derived macrophages
18922905 both ATF3 and Smad were crucially and synergistically involved in down-regulation of Id-1, which regulated JNK phosphorylation in REIC/Dkk-3-induced apoptosis.
18802113 IFN-gamma inhibits matrix metalloproteinase expression by inducing expression of transcriptional repressor ATF-3, which then participates in feedback inhibition of Toll-like receptor-induced gene expression in primary human macrophages.
18755691 ATF3 is a key mediator of KLF6-induced apoptosis in prostate cancer cells
18692824 Alterations in ATF3 gene expression resemble the response to mechanical and ischemic stress reported in other tissues.
18426833 ATF3 gene variants influence the risk of hypospadias
18426833 Observational study of gene-disease association. (HuGE Navigator)
18235102 ATF3 plays a protective role in renal ischemia-reperfusion injury and the mechanism of the protection may involve suppression of p53 and induction of p21
18192274 Sp1 recruits ATF3, c-Jun, and STAT3 to obtain the requisite synergistic effect in neuronal injury through DINE neuronal injury-inducible gene
18001166 17-alpha ethinyl estradiol upregulates ATF3 expression in human foreskin fibroblasts in vitro.
17952119 ATF3 has a dichotomous role in cancer development.
17599613 Coxsackievirus B3 (CVB3) infection markedly reduced ATF3 expression at mRNA and protein levels in parallel with p53 degradation, and preservation of p53 expression rescued CVB3 infection-induced ATF3 downregulation.
17437852 We found significant differences in gene expression, specifically with a group of genes, including ATF3, known to be responsive to estrogen or to interact with estrogen receptor.
17295236 ATF3 may have oncogenic properties in epithelial cells
17178897 The tumor metastasis suppressor gene Drg-1 suppresses metastasis of prostate tumor cells by inhibiting the invasive ability of the cells via down-regulation of the expression of the ATF3 gene.
17102133 expression of ATF-3 in hypoxic cells represses Id-1 and prevents their loss
17014422 results indicate that a major signalling pathway, the p38 pathway, plays a critical role in the induction of ATF3 by stress signals, and that ATF3 is functionally important to mediate the pro-apoptotic effects of p38
16989641 Initial increase in RNA pol II (RNA polymerase II) binding to the promoter and in the transcription rate from the ATF3 gene.
16912181 Transcription factor Wilms' tumor 1 and ATF3 Transcription Factor are activated in Wilms' tumor and accelerate tumorigenesis.
16613840 role in a novel mechanism used by interferon-induced serine/threonine protein kinase (PKR) to induce apoptosis
16484797 gene mapped to chromosome 1.
16306208 ATF3 is up-regulated in the penile skin tissues of boys with hypospadias, which suggests a role for this transcription factor in the development of this abnormality.
16286461 t10,c12-CLA stimulates ATF3/NAG-1 expression and subsequently induces apoptosis in an isomer specific manner
16263788 high expression of ATF3 is found in nearly all cases of cHL and is almost exclusively restricted to it
16109718 coordinated regulation of mRNA stability by HuR and AUF1 proteins contributes to the observed increase in ATF3 expression following amino acid limitation
16079301 this is a novel first report demonstrating that the expression of ATF3 occurs via early growth response gene-1 downstream of extracellular signal-regulated kinase1/2
15670751 The results suggest that I3C represses cell proliferation through up-regulation of NAG-1 and that ATF3 may play a pivotal role in DIM-induced NAG-1 expression in human colorectal cancer cells.
15385533 ATF3-FL and C/EBPbeta act as transcriptional suppressors for the ASNS gene to counterbalance the transcription rate activated by ATF4 following amino acid deprivation
15280448 Demonstrate the critical role of tyrosine phosphorylated ATF3 in IL-10 suppression of MMP-2 gene expression in primary human prostate tumor cells.
12881527 ATF3 isoforms have a role in the transcriptional regulation of the ASNS gene in response to nutrient deprivation
12833146 ATF-2 and ATF3 seem to play an important role in the protective response of human cells to ionizing radiation
12392999 ATF3 may function as a cytoprotective transcription factor in DOX-treated cardiac myocytes, at least in part, owing to downregulation of p53
12386811 induction of ATF3 protein, a member of the ATF/CREB family of transcription factors, by ionizing radiation requires normal cellular p53 function
12372430 human ATF3 gene is one of the target genes directly activated by p53
12161427 These results demonstrate that overexpression of Activating transcription factor 3 (ATF3) suppresses tumor necrosis factor-alpha-induced cell death of HUVECs, at least in part, through down-regulating the transcription of p53 gene.
12034827 An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli.
11810028 HIV-1 and the viral protein Tat modulate the expression of activating transcription factor 3 (ATF3) in immature dendritic cells and monocyte-derived macrophages
11792711 represses 72-kDa type IV collagenase expression by antagonizing p53-dependent trans-activation of the collagenase promoter
11726207 role of JNK-ATF3 pathway in apoptosis of vascular endothelial cells associated with hyperhomocysteinemia

AA Sequence

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR      1 - 70
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQ     71 - 140
HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS                                 141 - 181
//

Text Mined References (165)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26994140 2016 The Stress-responsive Gene ATF3 Mediates Dichotomous UV Responses by Regulating the Tip60 and p53 Proteins.
26851004 2016 Potential Dual Role of Activating Transcription Factor 3 in Colorectal Cancer.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26709509 2015 TGRL Lipolysis Products Induce Stress Protein ATF3 via the TGF-? Receptor Pathway in Human Aortic Endothelial Cells.
26418018 2015 Lysophosphatidic Acid Mediates Activating Transcription Factor 3 Expression Which Is a Target for Post-Transcriptional Silencing by miR-30c-2-3p.
26412238 2015 Activating transcription factor 3 represses inflammatory responses by binding to the p65 subunit of NF-?B.
26305977 2015 Role of activating transcription factor 3 in the synthesis of latency-associated transcript and maintenance of herpes simplex virus 1 in latent state in ganglia.
26051724 2015 The expression of ATF3, MMP-2 and maspin in tissue chip of glioma.
25931127 2015 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
25872784 2015 Activating transcription factor 3 is overexpressed in human glioma and its knockdown in glioblastoma cells causes growth inhibition both in vitro and in vivo.
25865756 2015 The stress-responsive gene ATF3 regulates the histone acetyltransferase Tip60.
25816118 2015 Computational networks of activating transcription factor 3 gene in Huh7 cell lines and hepatitis C virus-infected Huh7 cell lines.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25589515 2016 Activating transcription factor 3 regulates canonical TGF? signalling in systemic sclerosis.
25521189 2015 The catalytic topoisomerase II inhibitor dexrazoxane induces DNA breaks, ATF3 and the DNA damage response in cancer cells.
25447816 2014 The contribution of activating transcription factor 3 to apoptosis of human colorectal cancer cells by protocatechualdehyde, a naturally occurring phenolic compound.
25400120 2014 Activating transcription factor 3 (ATF3) in the human adrenal cortex: its possible involvement in aldosterone biosynthesis.
25380580 2015 Runx2, a target gene for activating transcription factor-3 in human breast cancer cells.
25268131 2014 Urotensin II inhibits doxorubicin-induced human umbilical vein endothelial cell death by modulating ATF expression and via the ERK and Akt pathway.
25189785 2014 Single-molecule quantification of lipotoxic expression of activating transcription factor 3.
25180886 2014 Pro-apoptotic action of macrophage inhibitory cytokine 1 and counteraction of activating transcription factor 3 in carrageenan-exposed enterocytes.
25150595 2015 A feedback expression of microRNA-590 and activating transcription factor-3 in human breast cancer cells.
25149542 2014 ATF3 functions as a novel tumor suppressor with prognostic significance in esophageal squamous cell carcinoma.
25122760 2014 Activating transcription factor 3-mediated chemo-intervention with cancer chemokines in a noncanonical pathway under endoplasmic reticulum stress.
25096061 2014 Transcriptional regulation of STAT3 by SPTBN1 and SMAD3 in HCC through cAMP-response element-binding proteins ATF3 and CREB2.
25074928 2014 Chronic ethanol consumption inhibits glucokinase transcriptional activity by Atf3 and triggers metabolic syndrome in vivo.
24939851 2014 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib.
24906227 2014 Low expression of activating transcription factor 3 in human hepatocellular carcinoma and its clinicopathological significance.
24859834 2014 Activating transcription factor 3 promotes colon cancer metastasis.
24600036 2014 PIKfyve, a class III lipid kinase, is required for TLR-induced type I IFN production via modulation of ATF3.
24554706 2014 The activating transcription factor 3 protein suppresses the oncogenic function of mutant p53 proteins.
24509533 2014 The oncogene ATF3 is potentiated by cyclosporine A and ultraviolet light A.
24469490 Activating transcription factor 3 is not up-regulated in hypospadias patients in Japan.
24460316 2013 ATF3 activates Stat3 phosphorylation through inhibition of p53 expression in skin cancer cells.
24420912 2014 Exosomal ATF3 RNA attenuates pro-inflammatory gene MCP-1 transcription in renal ischemia-reperfusion.
24133584 2013 Upregulation of ATF-3 is correlated with prognosis and proliferation of laryngeal cancer by regulating Cyclin D1 expression.
24098051 2013 Novel regulatory action of ribosomal inactivation on epithelial Nod2-linked proinflammatory signals in two convergent ATF3-associated pathways.
23921126 2013 Transcription factor ATF3 links host adaptive response to breast cancer metastasis.
23884832 2013 Expression profiling based on graph-clustering approach to determine osteoarthritis related pathway.
23868936 2013 Induction of ATF3 gene network by triglyceride-rich lipoprotein lipolysis products increases vascular apoptosis and inflammation.
23733932 2013 Regulatory interplay of Cockayne syndrome B ATPase and stress-response gene ATF3 following genotoxic stress.
23706953 2013 TLR4, ATF-3 and IL8 inflammation mediator expression correlates with seizure frequency in human epileptic brain tissue.
23648135 2013 Upregulation of ATF3 inhibits expression of the pro-inflammatory cytokine IL-6 during Neisseria gonorrhoeae infection.
23591848 2013 Loss of SUMOylation on ATF3 inhibits proliferation of prostate cancer cells by modulating CCND1/2 activity.
23560949 2013 Microarray analysis of altered gene expression and the role of ATF3 in HK-2 cells treated with hemin.
23536558 2013 ATF3 suppresses metastasis of bladder cancer by regulating gelsolin-mediated remodeling of the actin cytoskeleton.
23269699 2013 Elevated cJUN expression and an ATF/CRE site within the ATF3 promoter contribute to activation of ATF3 transcription by the amino acid response.
23187734 2013 Transcription factor ATF-3 regulates allele variation phenotypes of the human SLC11A1 gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088992 2012 Exploration of gene-environment interactions, maternal effects and parent of origin effects in the etiology of hypospadias.
23002211 2012 Adenylate kinase-4 is a marker of poor clinical outcomes that promotes metastasis of lung cancer by downregulating the transcription factor ATF3.
22991139 2013 SUMOylation of ATF3 alters its transcriptional activity on regulation of TP53 gene.
22989952 The bZIP repressor proteins, c-Jun dimerization protein 2 and activating transcription factor 3, recruit multiple HDAC members to the ATF3 promoter.
22978410 2013 Dynamic changes in genomic histone association and modification during activation of the ASNS and ATF3 genes by amino acid limitation.
22851689 2012 Activating transcription factor 3 regulates immune and metabolic homeostasis.
22768301 2012 The response of the prostate to circulating cholesterol: activating transcription factor 3 (ATF3) as a prominent node in a cholesterol-sensing network.
22764884 2012 The utility of ATF3 in distinguishing cutaneous squamous cell carcinoma among other cutaneous epithelial neoplasms.
22753726 2012 Enhancement of cisplatin cytotoxicity by disulfiram involves activating transcription factor 3.
22665497 2012 The stress response mediator ATF3 represses androgen signaling by binding the androgen receptor.
22485215 2011 Comparative study of the expression of ATF-3 and ATF-4 genes in vessels involved into atherosclerosis process and in psoriatic skin.
22475484 2012 ATF3 inhibits adipocyte differentiation of 3T3-L1 cells.
22347845 2012 Activating transcription factor 3 and the nervous system.
22179317 2011 ROS-induced ATF3 causes susceptibility to secondary infections during sepsis-associated immunosuppression.
22046379 2011 Systems analysis of ATF3 in stress response and cancer reveals opposing effects on pro-apoptotic genes in p53 pathway.
21927023 2012 Key role of ATF3 in p53-dependent DR5 induction upon DNA damage of human colon cancer cells.
21900211 2011 Transcriptional activity of ATF3 in the stromal compartment of tumors promotes cancer progression.
21844328 2011 Complementary cell-based high-throughput screens identify novel modulators of the unfolded protein response.
21821004 2011 ATF3 represses PDX-1 expression in pancreatic ?-cells.
21801305 2012 Salermide up-regulates death receptor 5 expression through the ATF4-ATF3-CHOP axis and leads to apoptosis in human cancer cells.
21668942 2011 COX-2 gene expression in colon cancer tissue related to regulating factors and promoter methylation status.
21645504 2011 Nicorandil attenuates cyclic strain-induced endothelin-1 expression via the induction of activating transcription factor 3 in human umbilical vein endothelial cells.
21629765 2011 Activating transcription factor 3, a useful marker for regenerative response after nerve root injury.
21593605 Gene expression profiling indicate role of ER stress in miR-23a~27a~24-2 cluster induced apoptosis in HEK293T cells.
21554132 2011 The dietary compounds resveratrol and genistein induce activating transcription factor 3 while suppressing inhibitor of DNA binding/differentiation-1.
21514952 2011 Steroids and extracellular signal-regulated kinase 1/2 activity suppress activating transcription factor 3 expression in patients with severe asthma.
21495874 2011 Acute kidney injury and the potential for ATF3-regulated epigenetic therapy.
21467165 2011 Expression of Id-1 is regulated by MCAM/MUC18: a missing link in melanoma progression.
21454613 2011 KAI1 gene is engaged in NDRG1 gene-mediated metastasis suppression through the ATF3-NFkappaB complex in human prostate cancer.
21451046 2011 Diffuse traumatic axonal injury in the mouse induces atrophy, c-Jun activation, and axonal outgrowth in the axotomized neuronal population.
21421043 2011 TREM-1 and DAP12 expression in monocytes of patients with severe psychiatric disorders. EGR3, ATF3 and PU.1 as important transcription factors.
21414204 2011 ATF3, an HTLV-1 bZip factor binding protein, promotes proliferation of adult T-cell leukemia cells.
21324310 2011 Effect of obesity on the association between ATF3 gene haplotypes and C-reactive protein level in Taiwanese.
21315420 2011 Increased expression of activating transcription factor 3 is related to the biologic behavior of cutaneous squamous cell carcinomas.
21294679 2011 Organelle stress-induced activating transcription factor-3 downregulates low-density lipoprotein receptor expression in Sk-Hep1 human liver cells.
21191795 2011 Angiotensin II signaling up-regulates the immediate early transcription factor ATF3 in the left but not the right atrium.
21129190 2010 Activating transcription factor-3 (ATF3) functions as a tumor suppressor in colon cancer and is up-regulated upon heat-shock protein 90 (Hsp90) inhibition.
21061913 2010 ATF3, a hub of the cellular adaptive-response network, in the pathogenesis of diseases: is modulation of inflammation a unifying component?
20930144 2010 ATF3, an adaptive-response gene, enhances TGF{beta} signaling and cancer-initiating cell features in breast cancer cells.
20696134 2010 ATF3 negatively regulates adiponectin receptor 1 expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581861 2010 Activating transcription factor 2 (ATF2) controls tolfenamic acid-induced ATF3 expression via MAP kinase pathways.
20485437 2010 Opposing roles for calcineurin and ATF3 in squamous skin cancer.
20423458 2010 AdipoR2 is transcriptionally regulated by ER stress-inducible ATF3 in HepG2 human hepatocyte cells.
20413626 2010 Activating transcription factor 3 confers protection against ventilator-induced lung injury.
20351107 2010 Differential gene expression downstream of Toll-like receptors (TLRs): role of c-Src and activating transcription factor 3 (ATF3).
20304822 2010 Activating transcription factor 3 is a positive regulator of human IFNG gene expression.
20215396 2010 Genetics of hypospadias: are single-nucleotide polymorphisms in SRD5A2, ESR1, ESR2, and ATF3 really associated with the malformation?
20180416 2009 [Expressions of ATF3 and CTGF and their regulation by estradiol in the prepuce of hypospadias patients].
20167600 2010 Activating transcription factor 3 activates p53 by preventing E6-associated protein from binding to E6.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20002170 2010 Activating transcription factor 3 (ATF3) expression is increased in erythema multiforme and is regulated by IFN-gamma in human keratinocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19582787 2009 Transforming growth factor-beta1 regulation of ATF-3 and identification of ATF-3 target genes in breast cancer cells.
19219066 2009 ATF3 and p15PAF are novel gatekeepers of genomic integrity upon UV stress.
19136462 2009 Differential usage of alternate promoters of the human stress response gene ATF3 in stress response and cancer cells.
19060337 2009 Dual regulation of Cdc25A by Chk1 and p53-ATF3 in DNA replication checkpoint control.
18922905 2008 Down-regulation of inhibition of differentiation-1 via activation of activating transcription factor 3 and Smad regulates REIC/Dickkopf-3-induced apoptosis.
18802113 2008 Lipopolysaccharide-induced expression of matrix metalloproteinases in human monocytes is suppressed by IFN-gamma via superinduction of ATF-3 and suppression of AP-1.
18755691 2008 KLF6 induces apoptosis in prostate cancer cells through up-regulation of ATF3.
18692824 2009 Activating transcription factor 3 gene expression suggests that tissue stress plays a role in leiomyoma development.
18426833 2008 Activating transcription factor 3: a hormone responsive gene in the etiology of hypospadias.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18235102 2008 ATF3 protects against renal ischemia-reperfusion injury.
18192274 2008 Neuronal injury-inducible gene is synergistically regulated by ATF3, c-Jun, and STAT3 through the interaction with Sp1 in damaged neurons.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18001166 Estradiol upregulates activating transcription factor 3, a candidate gene in the etiology of hypospadias.
17952119 2008 A potential dichotomous role of ATF3, an adaptive-response gene, in cancer development.
17599613 2007 Coxsackievirus B3 modulates cell death by downregulating activating transcription factor 3 in HeLa cells.
17437852 2007 Up-regulation of estrogen responsive genes in hypospadias: microarray analysis.
17295236 2007 Epidermal hyperplasia and oral carcinoma in mice overexpressing the transcription factor ATF3 in basal epithelial cells.
17178897 2006 The tumor metastasis suppressor gene Drg-1 down-regulates the expression of activating transcription factor 3 in prostate cancer.
17102133 2007 Hypoxic regulation of Id-1 and activation of the unfolded protein response are aberrant in neuroblastoma.
17014422 2007 The regulation of ATF3 gene expression by mitogen-activated protein kinases.
16989641 2007 Activation of the ATF3 gene through a co-ordinated amino acid-sensing response programme that controls transcriptional regulation of responsive genes following amino acid limitation.
16912181 2006 Wilms' tumor 1 and signal transducers and activators of transcription 3 synergistically promote cell proliferation: a possible mechanism in sporadic Wilms' tumor.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16613840 2006 Human gene profiling in response to the active protein kinase, interferon-induced serine/threonine protein kinase (PKR), in infected cells. Involvement of the transcription factor ATF-3 IN PKR-induced apoptosis.
16484797 2006 Assignment of UCK2, ATF3 and RGS18 from human chromosome 1 to porcine chromosomes 4, 9 and 10 with somatic and radiation hybrid panels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306208 2005 Activating transcription factor 3 is up-regulated in patients with hypospadias.
16300731 2006 ATF5 increases cisplatin-induced apoptosis through up-regulation of cyclin D3 transcription in HeLa cells.
16291753 2006 A splice variant of stress response gene ATF3 counteracts NF-kappaB-dependent anti-apoptosis through inhibiting recruitment of CREB-binding protein/p300 coactivator.
16286461 2006 Conjugated linoleic acid stimulates an anti-tumorigenic protein NAG-1 in an isomer specific manner.
16263788 2006 Classical Hodgkin lymphoma is characterized by high constitutive expression of activating transcription factor 3 (ATF3), which promotes viability of Hodgkin/Reed-Sternberg cells.
16109718 2005 Interaction of RNA-binding proteins HuR and AUF1 with the human ATF3 mRNA 3'-untranslated region regulates its amino acid limitation-induced stabilization.
16079301 2005 Transcriptional regulation of activating transcription factor 3 involves the early growth response-1 gene.
15670751 2005 Indole-3-carbinol and 3,3'-diindolylmethane induce expression of NAG-1 in a p53-independent manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385533 2004 Amino acid deprivation induces the transcription rate of the human asparagine synthetase gene through a timed program of expression and promoter binding of nutrient-responsive basic region/leucine zipper transcription factors as well as localized histone acetylation.
15280448 2004 Interleukin-10 induced activating transcription factor 3 transcriptional suppression of matrix metalloproteinase-2 gene expression in human prostate CPTX-1532 Cells.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685163 2004 Roles of CHOP/GADD153 in endoplasmic reticulum stress.
14667575 2003 ATF3 enhances c-Jun-mediated neurite sprouting.
12881527 2003 Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter.
12833146 2003 Induction of ATF3 by ionizing radiation is mediated via a signaling pathway that includes ATM, Nibrin1, stress-induced MAPkinases and ATF-2.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12718878 2003 A self-enabling TGFbeta response coupled to stress signaling: Smad engages stress response factor ATF3 for Id1 repression in epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392999 2002 ATF3 inhibits doxorubicin-induced apoptosis in cardiac myocytes: a novel cardioprotective role of ATF3.
12386811 2002 ATF3 induction following DNA damage is regulated by distinct signaling pathways and over-expression of ATF3 protein suppresses cells growth.
12372430 2002 Transcriptional activation of the human stress-inducible transcriptional repressor ATF3 gene promoter by p53.
12161427 2002 Transcriptional repressor activating transcription factor 3 protects human umbilical vein endothelial cells from tumor necrosis factor-alpha-induced apoptosis through down-regulation of p53 transcription.
12034827 2002 An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli.
11792711 2002 ATF3 represses 72-kDa type IV collagenase (MMP-2) expression by antagonizing p53-dependent trans-activation of the collagenase promoter.
11375399 2001 Activating transcription factor 3 induces DNA synthesis and expression of cyclin D1 in hepatocytes.
10327051 1999 The N-terminal transactivation domain of ATF2 is a target for the co-operative activation of the c-jun promoter by p300 and 12S E1A.
8649793 1996 Altered AP-1/ATF complexes in adenovirus-E1-transformed cells due to EIA-dependent induction of ATF3.
8622660 1996 Analysis of ATF3, a transcription factor induced by physiological stresses and modulated by gadd153/Chop10.
8576171 1996 ATF3 gene. Genomic organization, promoter, and regulation.
8152431 1994 Activating transcription factor-3 stimulates 3',5'-cyclic adenosine monophosphate-dependent gene expression.
7692236 1993 Cyclic AMP-independent ATF family members interact with NF-kappa B and function in the activation of the E-selectin promoter in response to cytokines.
7515060 1994 ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms.
2516827 1989 Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.