Property Summary

NCBI Gene PubMed Count 155
PubMed Score 162.90
PubTator Score 301.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.240 5.9e-04
group 4 medulloblastoma 1.800 3.0e-04
atypical teratoid / rhabdoid tumor 1.200 2.4e-04
medulloblastoma, large-cell 1.600 5.7e-07
ovarian cancer -1.100 4.8e-04

Gene RIF (91)

PMID Text
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26645581 increased expression of the gene encoding PKCepsilon and abundance of phosphorylated, transcriptionally active ATF2 were observed in advanced-stage melanomas and correlated with decreased FUK expression
26462148 Results reveal that mitochondrial ATF2 is associated with the induction of apoptosis and BRAF inhibitor resistance through Bim activation.
26153406 Neisseria meningitidis caused a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter.
25961023 ATF2 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and three miRNAs (miR-17, miR-92a, and miR-21) which target ATF2 mRNA are selectively secreted in exosomes from these cells
25456131 suppression of tumorigenesis by JNK requires ATF2.
25417007 More terminally differentiated human odontoblasts was ATF-2 positive, as compared to pulpal fibroblasts at various stages of differentiation: ATF-2 is more associated with cell survival rather than cell proliferation.
25258251 Study demonstrates the role of miR-622 in suppressing glioma invasion and migration mediated by ATF2, and shows that miR-622 expression inversely correlates with ATF2 in glioma patients
25141981 While expression of ATF-2 is not associated with outcome.
25096061 in human HCC tissues, SPTBN1 expression correlated negatively with expression levels of STAT3, ATF3, and CREB2; SMAD3 expression correlated negatively with STAT3 expression
25041846 study revealed that, autocrine soluble factors regulate dual but differential role of ATF-2 as a transcription factor or DNA repair protein, which collectively culminate in radioresistance of A549 cells.
24982422 zymosan-induced il23a mRNA expression is best explained through coordinated kappaB- and ATF2-dependent transcription; and (iii) il23a expression relies on complementary phosphorylation of ATF2 on Thr-69 and Thr-71 dependent on PKC and MAPK activities.
24968707 Study identified a potential target of miR-451, ATF2, and revealed a novel role of miR-451 in the inhibition of the migratory ability of hepatoma cell lines.
24966171 ATF-2 knockdown blocked VEGF-A-stimulated VCAM-1 expression and endothelial-leukocyte interactions. ATF-2 was also required for other endothelial cell outputs, such as cell migration and tubulogenesis.
24780446 Data show that salvianolic acid B protects endothelial progenitor cells against oxidative stress by modulating Akt/mTOR/4EBP1, p38 MAPK/ATF2, and ERK1/2 signaling pathways.
24338393 An association between ATF2 polymorphisms and heavy alcohol consumption is only weakly supported.
24289970 Cytoplasmic ATF2 expression was less frequently seen than nuclear expression in malignant mesenchymal tumors. Benign mesenchymal tumors mostly showed much lower nuclear and cytoplasmic ATF2 expression.
24223142 There is synergism between developmental stage-specific recruitments of the ATF2 protein complex and expression of gamma-globin during erythropoiesis.
23966864 we establish that ATF2 family members physically and functionally interact with TCF1/LEF1 factors to promote target gene expression and hematopoietic tumor cell growth
23866832 The expression of ATF2 in chondrocytes is involved in apoptosis in Kashin-Beck disease.
23800081 ATF2 knockdown revealed ATF2-triggered p21(WAF1) protein expression, suggesting p21(WAF1) transactivation through ATF2.
23656735 these studies show that the IL-1beta-induced increase in intestinal tight junction permeability was regulated by p38 kinase activation of ATF-2 and by ATF-2 regulation of MLCK gene activity
23591579 Increasing of ATF2 expression is mediated via oxidative stress induced by arsenic in SV-HUC-1 cells, and MAPK pathways are involved.
23589174 Data indicate that small molecules that block the oncogenic addiction to PKCepsilon signaling by promoting ATF2 nuclear export, resulting in mitochondrial membrane leakage and melanoma cell death.
23416976 results therefore suggest that c-MYC induces stress-mediated activation of ATF2 and ATF7 and that these transcription factors regulate apoptosis in response to oncogenic transformation of B cells
22843696 ATF2-Jun heterodimers bind IFNb in both orientations alone and in association with IRF3 and HMGI
22685333 Phosphorylation of ATF2 by PKCepsilon is the master switch that controls its subcellular localization and function.
22351776 we report the kinetic mechanism for JNK1beta1 with transcription factors ATF2 and c-Jun along with interaction kinetics for these substrates.
22304920 The ability of ATF2 to reach the mitochondria is determined by PKCepsilon, which directs ATF2 nuclear localization. Genotoxic stress attenuates PKCepsilon effect on ATF2; enables ATF2 nuclear export and localization at the mitochondria.
22275354 ATF2 subcellular localization is probably modulated by multiple mechanisms
21990224 Our data suggest regulatory roles for ATF2 in TNF-related mechanisms of Head and Neck Squamous Cell Carcinoma. Its perturbation and nuclear activation are associated with significant effects on survival and cytokine production.
21901137 Data concluded that IR-induced up-regulation of ATF2 was coordinately enhanced by suppression of miR-26b in lung cancer cells, which may enhance the effect of IR in the MAPK signaling pathway.
21858082 Data show that ATF7-4 is an important cytoplasmic negative regulator of ATF7 and ATF2 transcription factors.
21384452 Data suggest that competition between GSTpi and active JNK for the substrate ATF2 may be responsible for the inhibition of JNK catalysis by GSTpi.
21278380 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
21203491 MITF is downregulated by ATF2 in the skin of Atf2-/- mice, in primary human melanocytes, and in melanoma cell lines.
21098032 hyperosmotic stress can activate the Plk3 signaling pathway that subsequently regulates the AP-1 complex by directly phosphorylating ATF-2 independent from the effects of JNK and p38 activation.
20675274 Results suggest that Fra-2 protein may be more effective than ATF-2 protein in cyst formation originated from epithelial cells of dental follicles.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619956 calorimetric studies of atf-2 and c-jun transcription factors
20581861 Overexpression of ATF2 resulted in significant increase in ATF3 promoter activity, and electrophoretic mobility shift assay identified this region as a core sequence to which ATF2 binds
20507983 Growth factor-independent signaling pathways converge in the formation of an active c-Jun.AFT2 dimer, which induces the expression of the anti-apoptotic factor Bcl-X(L) that mediates a pro-survival response.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20116378 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20068037 ATF2 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and three miRNAs (miR-17, miR-92a, and miR-21) which target ATF2 mRNA are selectively secreted in exosomes from these cells
20051382 rapid phosphorylation of p38 mitogen-activated protein kinase and activating transcription factor 2 also takes place in IM-9 lymphoblastoid cells, which naturally express GPR55, after stimulation with LPI
19944700 Stability and DNA-binding ability of the bZIP dimers formed by the ATF-2 and c-Jun.
19923798 JNK/ATF2 pathway is involved in iodinated contrast media-induced apoptosis
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822663 Data reveal a new signaling pathway activated by amino acid starvation leading to ATF2 phosphorylation and subsequently positively affecting the transcription of amino acid-regulated genes.
19712049 show that Activating transcription factor 2 induction enhances hypoxia-inducible factor 1alpha protein stability via direct protein interaction.
19487697 Phospholipase D1 acts as an important regulator in house dust mite allergen Der f 2-induced expression and production of IL-13 through activation of activating transcription factor-2 activation in human bronchial epithelial cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19331149 Breast cancer patients with high ATF2 expression as detected by WB had a significantly shorter overall survival.
19278424 P-ATF2 and p-STAT3 are concordantly overexpressed in extramammary Paget's disease and their expressions may possibly be associated with the tumor stage.
19184334 Data show that individuals who are homozygous for the short AP-2 beta allele display higher depression scores when psychosocial adversity is taken into account.
19176525 the phosphorylation of ATF-2 at Ser-121 plays a key role in the c-Jun-mediated activation of transcription that occurs in response to TPA.
19082758 p53 and ATF-2 partly mediate the overexpression of COX-2 in H(2)O (2)-induced premature senescence of human fibroblasts.
18700251 overexpression of p-ATF2, p-STAT3 and possibly p53, but not p63 or p73, may contribute to the tumorigenesis of cutaneous vascular tumors.
18677098 This review summarizes the current understanding of ATF2 regulation and function.
18671972 IRF2-BP1 is a JDP2-binding protein enhancing the polyubiquitination of JDP2 and represses ATF2-mediated transcriptional activation from a CRE-containing promoter.
18547788 Overexpression of phosphorylated-ATF2 and STAT3 in cutaneous squamous cell carcinoma, Bowen's disease and basal cell carcinoma.
18397884 analysis of regulation of ATM activation by ATF2-dependent control of TIP60 stability and activity
18348191 review of signaling pathways that activate ATF-2, as well as its downstream targets [review]
18077426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17869487 ATF2/STAT3 signaling pathways are activated and may play a role in development of eccrine porocarcinoma and eccrine poroma.
17681939 The transcription factor ATF2, which is phosphorylated and activated by JNK, is a critical mediator for inducible expression of DUSP1 and DUSP10 in this signaling pathway.
17626013 ATF2, but not CREB, was a target for the TAK1-JNK pathway, and p38 negatively regulated TAK1 activity through TAB1 phosphorylation.
17337306 ATF-2 may be a key regulator of the human insulin promoter possibly stimulating activity in response to extracellular signals.
17258390 This study demonstrates that ATF2 mediates the TGF-beta-induced MMP-2 transcriptional activation, elucidating a molecular mechanism for the malignant progression of human breast epithelial cells exerted by TGF-beta.
17244683 Shear stress and KLF2 inhibit nuclear activity of ATF2, providing a potential mechanism by which endothelial cells exposed to laminar flow are protected from basal proinflammatory, atherogenic gene expression.
17082618 Binding of ATF2 to the CD1A promoter in human monocytes suggests a role for ATF/cAMP response element binding protein family members in regulation of CD1A expression.
17054722 Sin1 may contribute to ATF-2 signaling specificity by acting as a nuclear scaffold.
16896160 gamma-gene induction by butyrate and trichostatin A involves ATF-2 and CREB1 activation via p38 MAPK signaling.
16869889 These studies establish p38 MAP kinase-mediated activation of ATF-2 as a significant mechanism in amylin-evoked beta-cell death, which may serve as a target for pharmaceutical intervention and effective suppression of beta-cell failure in type-2 diabetes.
16418168 Resistin induces PTEN expression by activating stress signaling p38 pathway, which may activate target transcription factor ATF-2, which in turn induces PTEN expression
16179804 ATF2 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and three miRNAs (miR-17, miR-92a, and miR-21) which target ATF2 mRNA are selectively secreted in exosomes from these cells
16049073 activity of the AP-1 components c-Jun, ATF2, and c-Fos is altered in renal cystic tissue of patients with autosomal dominant polycystic kidney disease
15916964 Data demonstrate that the protein kinase ATM phosphorylates ATF2 on serines 490 and 498 following ionizing radiation (IR).
15878807 ATF2 expression in the neuron of normal human brain. But downregulation in the Neurodegenerative Disease( Alzheimer disease, Huntington disease and Parkinson disease).
15691875 genes affected by ATF2 and ATF2-sm appear to belong to discrete groups
14988408 ATF2 and HO-1 are regulated and induced by biliverdin reductase
14734562 differentiation-dependent expression and phosphorylation of ATF2 protein physically and functionally interacts with C/EBPalpha and coativator ASC-2 and synergizes to induce target gene transcription during granulocytic differentiation
14678960 In melanoma strong cytoplasmic ATF2 expression was associated with primary specimens rather than metastases and with better survival. Strong nuclear ATF2 expression was associated with metastatic specimens and with poor survival.
14630918 ATF4 and ATF2 have roles in regulating CHOP expression
12833146 ATF-2 and ATF3 seem to play an important role in the protective response of human cells to ionizing radiation
12663670 JNK-dependent phosphorylation of ATF2 plays an important role in the drug resistance phenotype likely by mediating enhanced DNA repair by a p53-independent mechanism.
12592382 Phosphorylation of one of the downstream transcriptional factors of MAPK cascade, ATF2, was 3.2- and 2.0-fold induced by TPA and Saikosaponin a, respectively.
12270648 Observational study of gene-disease association. (HuGE Navigator)
12110590 activation by growth factors via phosphorylation of Thr71 through the Ras-MEK-ERK pathway and of Thr69 through RalGDS-Src-p38
11836564 Infrequent mutations of the activating transcription factor-2 gene in human lung cancer, neuroblastoma and breast cancer

AA Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTP      1 - 70
TPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPH     71 - 140
PESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVP    141 - 210
VPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKA    211 - 280
ALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANED    281 - 350
PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV    351 - 420
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALS    421 - 490
QIVMAPSSQSQPSGS                                                           491 - 505
//

Text Mined References (170)

PMID Year Title
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26645581 2015 The transcription factor ATF2 promotes melanoma metastasis by suppressing protein fucosylation.
26462148 2015 Mitochondrial ATF2 translocation contributes to apoptosis induction and BRAF inhibitor resistance in melanoma through the interaction of Bim with VDAC1.
26153406 2016 A critical role for ATF2 transcription factor in the regulation of E-selectin expression in response to non-endotoxin components of Neisseria meningitidis.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25456131 2014 JNK suppresses tumor formation via a gene-expression program mediated by ATF2.
25417007 2015 ATF-2 immunoreactivity in post-mitotic and terminally differentiated human odontoblasts.
25416956 2014 A proteome-scale map of the human interactome network.
25368329 2014 Human macrophage SCN5A activates an innate immune signaling pathway for antiviral host defense.
25258251 2015 MiR-622 suppresses proliferation, invasion and migration by directly targeting activating transcription factor 2 in glioma cells.
25141981 2014 Phosphorylation of activating transcription factor-2 (ATF-2) within the activation domain is a key determinant of sensitivity to tamoxifen in breast cancer.
25096061 2014 Transcriptional regulation of STAT3 by SPTBN1 and SMAD3 in HCC through cAMP-response element-binding proteins ATF3 and CREB2.
25041846 2014 Differential roles of ATF-2 in survival and DNA repair contributing to radioresistance induced by autocrine soluble factors in A549 lung cancer cells.
24982422 2014 The unfolded protein response and the phosphorylations of activating transcription factor 2 in the trans-activation of il23a promoter produced by ?-glucans.
24968707 2014 MicroRNA-451 regulates activating transcription factor 2 expression and inhibits liver cancer cell migration.
24966171 2014 VEGF-A isoforms differentially regulate ATF-2-dependent VCAM-1 gene expression and endothelial-leukocyte interactions.
24780446 2014 Salvianolic acid B protects human endothelial progenitor cells against oxidative stress-mediated dysfunction by modulating Akt/mTOR/4EBP1, p38 MAPK/ATF2, and ERK1/2 signaling pathways.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24338393 2013 Critical evaluation of transcription factor Atf2 as a candidate modulator of alcohol preference in mouse and human populations.
24289970 2014 Activating transcription factor 2 in mesenchymal tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223142 2013 Regulation of G?-globin gene by ATF2 and its associated proteins through the cAMP-response element.
23966864 2013 ?-Catenin-independent activation of TCF1/LEF1 in human hematopoietic tumor cells through interaction with ATF2 transcription factors.
23866832 2013 The expression of p-ATF2 involved in the chondeocytes apoptosis of an endemic osteoarthritis, Kashin-Beck disease.
23800081 2013 ATF2 knockdown reinforces oxidative stress-induced apoptosis in TE7 cancer cells.
23656735 2013 Mechanism of IL-1? modulation of intestinal epithelial barrier involves p38 kinase and activating transcription factor-2 activation.
23591579 2013 Oxidative stress and MAPK involved into ATF2 expression in immortalized human urothelial cells treated by arsenic.
23589174 2013 Inhibition of melanoma growth by small molecules that promote the mitochondrial localization of ATF2.
23416976 2014 Sensitisation of c-MYC-induced B-lymphoma cells to apoptosis by ATF2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843696 2012 Opposite orientations of a transcription factor heterodimer bind DNA cooperatively with interaction partners but have different effects on interferon-? gene transcription.
22685333 2012 ATF2 - at the crossroad of nuclear and cytosolic functions.
22439931 2012 Deconstruction of the SS18-SSX fusion oncoprotein complex: insights into disease etiology and therapeutics.
22351776 2012 Enzyme kinetics and interaction studies for human JNK1?1 and substrates activating transcription factor 2 (ATF2) and c-Jun N-terminal kinase (c-Jun).
22304920 2012 PKC? promotes oncogenic functions of ATF2 in the nucleus while blocking its apoptotic function at mitochondria.
22275354 2012 Critical role of N-terminal end-localized nuclear export signal in regulation of activating transcription factor 2 (ATF2) subcellular localization and transcriptional activity.
21990224 2011 Activating transcription factor-2 in survival mechanisms in head and neck carcinoma cells.
21901137 2011 Coordinated regulation of ATF2 by miR-26b in ?-irradiated lung cancer cells.
21858082 2011 A cytoplasmic negative regulator isoform of ATF7 impairs ATF7 and ATF2 phosphorylation and transcriptional activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21384452 2011 GST pi modulates JNK activity through a direct interaction with JNK substrate, ATF2.
21278380 2011 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
21203491 2010 A role for ATF2 in regulating MITF and melanoma development.
21098032 2011 Hyperosmotic stress-induced ATF-2 activation through Polo-like kinase 3 in human corneal epithelial cells.
20675274 2010 Immunoreactivity of ATF-2 and Fra-2 in human dental follicle.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619956 2010 Unfolding of bZIP dimers formed by the ATF-2 and c-Jun transcription factors is not a simple two-state transition.
20581861 2010 Activating transcription factor 2 (ATF2) controls tolfenamic acid-induced ATF3 expression via MAP kinase pathways.
20511396 2010 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo.
20507983 2010 Growth factor stimulation induces cell survival by c-Jun. ATF2-dependent activation of Bcl-XL.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20116378 2010 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20051382 2010 Lysophosphatidylinositol induces rapid phosphorylation of p38 mitogen-activated protein kinase and activating transcription factor 2 in HEK293 cells expressing GPR55 and IM-9 lymphoblastoid cells.
19944700 2010 Stability and DNA-binding ability of the bZIP dimers formed by the ATF-2 and c-Jun transcription factors.
19923798 2010 JNK/ATF2 pathway is involved in iodinated contrast media-induced apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861239 2010 cJun modulates Ggamma-globin gene expression via an upstream cAMP response element.
19822663 2009 Identification of a novel amino acid response pathway triggering ATF2 phosphorylation in mammals.
19712049 2009 Activating transcription factor 2 increases transactivation and protein stability of hypoxia-inducible factor 1alpha in hepatocytes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19487697 2009 House dust mite allergen Der f 2-induced phospholipase D1 activation is critical for the production of interleukin-13 through activating transcription factor-2 activation in human bronchial epithelial cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19331149 2009 Expression and prognostic value of activating transcription factor 2 (ATF2) and its phosphorylated form in mammary carcinomas.
19278424 2009 Concordant overexpression of phosphorylated ATF2 and STAT3 in extramammary Paget's disease.
19184334 2009 Transcription factor AP-2 beta genotype and psychosocial adversity in relation to adolescent depressive symptomatology.
19176525 2009 Phosphorylation of Activation Transcription Factor-2 at Serine 121 by Protein Kinase C Controls c-Jun-mediated Activation of Transcription.
19135240 2009 Regulation of PKD by the MAPK p38delta in insulin secretion and glucose homeostasis.
19082758 2009 p53 and ATF-2 partly mediate the overexpression of COX-2 in H(2)O (2)-induced premature senescence of human fibroblasts.
18700251 2008 Overexpression of phosphorylated-ATF2 and STAT3 in cutaneous angiosarcoma and pyogenic granuloma.
18677098 2008 ATF2: a transcription factor that elicits oncogenic or tumor suppressor activities.
18671972 2008 IRF2-binding protein-1 is a JDP2 ubiquitin ligase and an inhibitor of ATF2-dependent transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18547788 2008 Overexpression of phosphorylated-ATF2 and STAT3 in cutaneous squamous cell carcinoma, Bowen's disease and basal cell carcinoma.
18397884 2008 Regulation of TIP60 by ATF2 modulates ATM activation.
18348191 2008 The role of ATF-2 in oncogenesis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18077426 2007 Runs of homozygosity reveal highly penetrant recessive loci in schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17869487 2008 Overexpression of phosphorylated ATF2 and STAT3 in eccrine porocarcinoma and eccrine poroma.
17681939 2007 Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress.
17626013 2007 Constitutive activation of TAK1 by HTLV-1 tax-dependent overexpression of TAB2 induces activation of JNK-ATF2 but not IKK-NF-kappaB.
17590016 2007 Multiple roles for acetylation in the interaction of p300 HAT with ATF-2.
17337306 2007 ATF-2 stimulates the human insulin promoter through the conserved CRE2 sequence.
17258390 2007 TGF-beta-induced transcriptional activation of MMP-2 is mediated by activating transcription factor (ATF)2 in human breast epithelial cells.
17254968 2007 PRAK is essential for ras-induced senescence and tumor suppression.
17244683 2007 Prolonged shear stress and KLF2 suppress constitutive proinflammatory transcription through inhibition of ATF2.
17082618 2006 Activating transcription factor/cAMP response element binding protein family member regulated transcription of CD1A.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17054722 2006 Sin1 binds to both ATF-2 and p38 and enhances ATF-2-dependent transcription in an SAPK signaling pathway.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16896160 2006 Mechanism for fetal hemoglobin induction by histone deacetylase inhibitors involves gamma-globin activation by CREB1 and ATF-2.
16869889 2006 Activation of activating transcription factor 2 by p38 MAP kinase during apoptosis induced by human amylin in cultured pancreatic beta-cells.
16533805 2006 Interacting JNK-docking sites in MKK7 promote binding and activation of JNK mitogen-activated protein kinases.
16511568 2006 Mutual regulation of c-Jun and ATF2 by transcriptional activation and subcellular localization.
16418168 2006 Up-regulation of PTEN (phosphatase and tensin homolog deleted on chromosome ten) mediates p38 MAPK stress signal-induced inhibition of insulin signaling. A cross-talk between stress signaling and insulin signaling in resistin-treated human endothelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16300731 2006 ATF5 increases cisplatin-induced apoptosis through up-regulation of cyclin D3 transcription in HeLa cells.
16049073 2005 Increased activity of activator protein-1 transcription factor components ATF2, c-Jun, and c-Fos in human and mouse autosomal dominant polycystic kidney disease.
15916964 2005 ATM-dependent phosphorylation of ATF2 is required for the DNA damage response.
15878807 2005 Activating transcription factor 2 expression in the adult human brain: association with both neurodegeneration and neurogenesis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15691875 2005 Identification of human myometrial target genes of the c-Jun NH2-terminal kinase (JNK) pathway: the role of activating transcription factor 2 (ATF2) and a novel spliced isoform ATF2-small.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304344 2004 Signalling pathways involved in multisite phosphorylation of the transcription factor ATF-2.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15105425 2004 Human vaccinia-related kinase 1 (VRK1) activates the ATF2 transcriptional activity by novel phosphorylation on Thr-73 and Ser-62 and cooperates with JNK.
14988408 2004 Biliverdin reductase, a novel regulator for induction of activating transcription factor-2 and heme oxygenase-1.
14734562 2004 Activation and interaction of ATF2 with the coactivator ASC-2 are responsive for granulocytic differentiation by retinoic acid.
14678960 2003 Subcellular localization of activating transcription factor 2 in melanoma specimens predicts patient survival.
14630918 2004 Induction of CHOP expression by amino acid limitation requires both ATF4 expression and ATF2 phosphorylation.
12833146 2003 Induction of ATF3 by ionizing radiation is mediated via a signaling pathway that includes ATM, Nibrin1, stress-induced MAPkinases and ATF-2.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12788955 2003 A docking site in MKK4 mediates high affinity binding to JNK MAPKs and competes with similar docking sites in JNK substrates.
12663670 2003 The activation of c-Jun NH2-terminal kinase (JNK) by DNA-damaging agents serves to promote drug resistance via activating transcription factor 2 (ATF2)-dependent enhanced DNA repair.
12592382 2003 ERK signaling pathway is involved in p15INK4b/p16INK4a expression and HepG2 growth inhibition triggered by TPA and Saikosaponin a.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270648 2002 No association between a transcription factor Activating Protein 2beta (AP-2beta) gene variant and schizophrenia.
12200150 2002 CREB DNA binding activation by a 50-Hz magnetic field in HL60 cells is dependent on extra- and intracellular Ca(2+) but not PKA, PKC, ERK, or p38 MAPK.
12110590 2002 Growth factors can activate ATF2 via a two-step mechanism: phosphorylation of Thr71 through the Ras-MEK-ERK pathway and of Thr69 through RalGDS-Src-p38.
11932306 2002 Characterization and functional analysis of cAMP response element modulator protein and activating transcription factor 2 (ATF2) isoforms in the human myometrium during pregnancy and labor: identification of a novel ATF2 species with potent transactivation properties.
11713276 2001 TIP49b, a regulator of activating transcription factor 2 response to stress and DNA damage.
11259586 2001 p38 mitogen-activated protein kinase-dependent activation of protein phosphatases 1 and 2A inhibits MEK1 and MEK2 activity and collagenase 1 (MMP-1) gene expression.
11231009 2001 Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2.
10909971 2000 Activating transcription factor-2 is a positive regulator in CaM kinase IV-induced human insulin gene expression.
10878576 2000 p38 MAPK signalling cascades: ancient roles and new functions.
10821277 2000 ATF-2 has intrinsic histone acetyltransferase activity which is modulated by phosphorylation.
10567391 1999 The role of human MBF1 as a transcriptional coactivator.
10393177 1999 A Caenorhabditis elegans JNK signal transduction pathway regulates coordinated movement via type-D GABAergic motor neurons.
10357819 1999 The role of HMG I(Y) in the assembly and function of the IFN-beta enhanceosome.
10327051 1999 The N-terminal transactivation domain of ATF2 is a target for the co-operative activation of the c-jun promoter by p300 and 12S E1A.
10092462 1999 Solution structure of the transactivation domain of ATF-2 comprising a zinc finger-like subdomain and a flexible subdomain.
10085140 1999 ATF-2 is a common nuclear target of Smad and TAK1 pathways in transforming growth factor-beta signaling.
9920921 1999 A testis-specific androgen receptor coregulator that belongs to a novel family of nuclear proteins.
9873047 1999 Cloning and characterization of RLPK, a novel RSK-related protein kinase.
9748258 1998 Characterization of functional domains of an embryonic stem cell coactivator UTF1 which are conserved and essential for potentiation of ATF-2 activity.
9685505 1998 Casein kinase II interacts with the bZIP domains of several transcription factors.
9671405 1998 Modulation of Fos-mediated AP-1 transcription by the promyelocytic leukemia protein.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9524124 1998 UTF1, a novel transcriptional coactivator expressed in pluripotent embryonic stem cells and extra-embryonic cells.
9488727 1998 Association of activating transcription factor 2 (ATF2) with the ubiquitin-conjugating enzyme hUBC9. Implication of the ubiquitin/proteasome pathway in regulation of ATF2 in T cells.
9445037 1998 An ATF/CRE element mediates both EBNA2-dependent and EBNA2-independent activation of the Epstein-Barr virus LMP1 gene promoter.
9430721 1998 Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.
9207191 1997 Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles.
9139739 1997 ATF-2 and C/EBPalpha can form a heterodimeric DNA binding complex in vitro. Functional implications for transcriptional regulation.
9110174 1997 Large-scale concatenation cDNA sequencing.
9058782 1997 Identification of a novel, spliced variant of CREB that is preferentially expressed in the thymus.
9030721 1997 Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.
8855261 1996 Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.
8798441 1996 CREB proteins function as positive regulators of the translocated bcl-2 allele in t(14;18) lymphomas.
8628277 1996 Fos-Jun dimerization promotes interaction of the basic region with TFIIE-34 and TFIIF.
8440710 1993 Isolation and characterization of a novel member of the gene family encoding the cAMP response element-binding protein CRE-BP1.
7737130 1995 ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents.
7737129 1995 ATF-2 contains a phosphorylation-dependent transcriptional activation domain.
7535770 1995 Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.
2529117 1989 Leucine zipper structure of the protein CRE-BP1 binding to the cyclic AMP response element in brain.
2521922 1989 A cluster of phosphorylation sites on the cyclic AMP-regulated nuclear factor CREB predicted by its sequence.
2516827 1989 Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.
2320002 1990 A cDNA for a human cyclic AMP response element-binding protein which is distinct from CREB and expressed preferentially in brain.
2196176 1990 Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain.
1838349 1991 Assignment of the gene for cyclic AMP-response element binding protein 2 (CREB2) to human chromosome 2q24.1-q32.
1833307 1991 Assignment of the human CREB2 (CRE-BP1) gene to 2q32.
1828107 1991 Identification of multiple nuclear factors that interact with cyclic adenosine 3',5'-monophosphate response element-binding protein and activating transcription factor-2 by protein-protein interactions.
1827203 1991 Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity.
1641004 1992 Retinoblastoma gene product activates expression of the human TGF-beta 2 gene through transcription factor ATF-2.
602896 1977 Cystitis emphysematosa.