Property Summary

NCBI Gene PubMed Count 14
PubMed Score 71.06
PubTator Score 35.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.1e-04
acute quadriplegic myopathy 1.291 7.2e-05
diabetes mellitus -1.100 1.2e-03

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
25381249 Data indicate that arginyltransferase 1 (ATE1) function controls Myocardin-related transcription factor A (MRTF-A) activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT      1 - 70
CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL     71 - 140
KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE    141 - 210
IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPP    211 - 280
SSQFKATLLESYQVYKRYQMVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI    281 - 350
IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG    351 - 420
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK    421 - 490
DPSEEAAVLQYASLVGQKCSERMLLFRN                                              491 - 518
//

Text Mined References (18)

PMID Year Title
25381249 2014 Inhibition of arginyltransferase 1 induces transcriptional activity of myocardin-related transcription factor A (MRTF-A) and promotes directional migration.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22665520 2012 Arginylation-dependent regulation of a proteolytic product of talin is essential for cell-cell adhesion.
22280815 2012 Small molecule inhibitors of arginyltransferase regulate arginylation-dependent protein degradation, cell motility, and angiogenesis.
22262859 2012 The C-terminal proteolytic fragment of the breast cancer susceptibility type 1 protein (BRCA1) is degraded by the N-end rule pathway.
21269460 2011 Initial characterization of the human central proteome.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16943202 2006 Arginyltransferase, its specificity, putative substrates, bidirectional promoter, and splicing-derived isoforms.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16002466 2005 Identification of mammalian arginyltransferases that modify a specific subset of protein substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9858543 1999 Alternative splicing results in differential expression, activity, and localization of the two forms of arginyl-tRNA-protein transferase, a component of the N-end rule pathway.