Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.39
PubTator Score 4.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.900 3.4e-03
posterior fossa group A ependymoma -3.000 5.6e-17
atypical teratoid / rhabdoid tumor -2.500 2.7e-06
medulloblastoma, large-cell -2.100 4.6e-04
pediatric high grade glioma -1.700 1.1e-03
group 3 medulloblastoma -2.300 4.8e-04
lung carcinoma 1.100 2.7e-17
spina bifida 1.204 4.8e-02

 GWAS Trait (1)

Gene RIF (3)

PMID Text
23226316 Caytaxin's role in maintaining normal neuronal function
19861499 caytaxin binds to kinesin-1 and functions as an adaptor that mediates intracellular transport of specific cargos, one of which is the mitochondrion.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINI      1 - 70
SLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGD     71 - 140
GTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYI    141 - 210
MENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTV    211 - 280
LAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP    281 - 350
EVAPVENRSALVSEDQETSMS                                                     351 - 371
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23226316 2012 Expression of Caytaxin protein in Cayman Ataxia mouse models correlates with phenotype severity.
21782286 2011 A genome-wide association study of aging.
21369758 2011 Cayman ataxia-related protein is a presynapse-specific caspase-3 substrate.
19861499 2009 Cayman ataxia protein caytaxin is transported by kinesin along neurites through binding to kinesin light chains.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18628984 2008 Nerve growth factor stimulates interaction of Cayman ataxia protein BNIP-H/Caytaxin with peptidyl-prolyl isomerase Pin1 in differentiating neurons.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16899818 2006 Brain-specific BNIP-2-homology protein Caytaxin relocalises glutaminase to neurite terminals and reduces glutamate levels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14556008 2003 Mutations in a novel gene encoding a CRAL-TRIO domain cause human Cayman ataxia and ataxia/dystonia in the jittery mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8845847 1996 A cerebellar ataxia locus identified by DNA pooling to search for linkage disequilibrium in an isolated population from the Cayman Islands.