Property Summary

NCBI Gene PubMed Count 30
PubMed Score 150.91
PubTator Score 73.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 1.500 8.4e-07
glioblastoma 1.400 1.9e-06
oligodendroglioma 1.100 4.9e-07
ependymoma 1.100 1.5e-05
group 3 medulloblastoma 2.200 6.6e-05
medulloblastoma, large-cell 2.000 4.5e-06
primitive neuroectodermal tumor 1.500 3.7e-03
Atopic dermatitis 1.100 6.6e-05
adrenocortical carcinoma 1.526 3.0e-03
tuberculosis and treatment for 6 months 1.300 1.5e-04
non-small cell lung cancer 2.565 2.8e-28
intraductal papillary-mucinous carcinoma... 2.000 4.2e-03
intraductal papillary-mucinous neoplasm ... 2.300 2.6e-03
lung cancer 2.200 3.8e-05
active Crohn's disease 1.089 8.2e-03
pancreatic cancer 1.100 7.9e-04
pediatric high grade glioma 1.300 3.6e-04
atypical teratoid/rhabdoid tumor 1.100 2.8e-04
nasopharyngeal carcinoma 2.000 2.6e-06
Breast cancer 2.000 4.0e-12
breast carcinoma 1.800 2.8e-32
ductal carcinoma in situ 1.800 1.2e-02
invasive ductal carcinoma 3.000 4.2e-04
ulcerative colitis 1.300 5.1e-05
ovarian cancer 1.800 1.0e-03

Gene RIF (21)

PMID Text
26819280 Results showed that ATPase family AAA domain-containing 2 overexpression was associated with progression and prognosis of colorectal cancer.
26497681 Suppression of ATAD2 impaired the growth of HepG2 and Hep3B subcutaneous xenografts, by enhancing apoptosis and p-p53 and p-p38 levels.
26308378 Data indicate that gene expression alterations in endometrial carcinoma samples with high ATPase family, AAA domain containing 2 protein (ATAD2) expression showed upregulation of several cancer-related genes including B-MYB gene.
25934333 We identified ANCCA protein expression as a novel independent poor prognostic indicator in endometrial carcinoma
25813398 Cervical cancer tissues may have highly expressed ATAD2. Oncogene ATAD2 may play an important role in cervical cancer proliferation, invasion and migration.
25377252 Data highlight the implication of Yta7 not only in gene expression, as expected, but also in genome organization, as a possible histone chaperone acting at boundary sites and regulating transcription. [review]
24805933 Results found that ATAD2 is highly expressed in hepatocellular carcinoma tissues and could affect the expression of hedghog pathway.
24761900 High expression of ATAD2 is associated with ovarian carcinomas
24552534 miR-372 suppressed the expression of ATAD2, which was highly expressed in HCC and exerted a proto-oncogene effect in hepatic carcinogenesis.
24391143 Study reveals ANCCA as a key mediator of kinesin family deregulation in breast cancer and the crucial role of multiple kinesins in growth and survival of the tumor cells.
23775406 High ANCCA protein expression is associated with lymphatic metastasis in lung adenocarcinoma.
23393560 Data indicate high ATAD2 expression is a marker of aggressive endometrial cancers, and suggest specific inhibitors of ATAD2 may have therapeutic utility in these and other MYC-dependent cancers.
22914773 However, only ATAD2, and not MYC, overexpression explained the behavior of proliferation-related genes and predicted a worse prognosis independently of disease stage in a large validation cohort
22771493 Data conclude that AR and E2F1 cooperation results from a chromatin looping over the ATAD2 promoter region between the ARBS and E2F1 binding site in an androgen-dependent manner
20864510 Data show that that ANCCA is crucial for proliferation and survival of triple-negative/basal-like cancer cells and that it controls the expression of B-Myb and histone methyltransferase EZH2.
20855524 Data report that ANCCA directly interacts with E2F1 to E2F3 in its complex with MLL and that its N terminus interacts with both the N and C termini of E2F1.
20374707 Genetic aberrations and dysregulation in expression of p160/SRC coactivators and the ANCCA in breast cancer, prostate cancer, and other nonhormone-responsive cancers, are reviewed.
19843847 ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.
19318566 Findings suggest that ANCCA plays an important role in prostate cancer by mediating specific AR functions in cancer cell survival and proliferation.
19318566 ANCCA interacts with AR, required for IGF1R,IRS-2,SGK1, survivin expression and proliferation and survival of prostate cancer cells. ANCCA itself is highly induced by androgen. Its overexpression is found in prostate cancers with high Gleason scores.
17998543 ANCCA associates directly with ERalpha and ACTR. It is selectively recruited to a subset of ERalpha target genes (cyclin D1, c-myc, and E2F1) and is required for their estrogen-induced expression and breast cancer cell proliferation.

AA Sequence

MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHR      1 - 70
TRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQ     71 - 140
STEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNTAEAVLQKMDDMKKMRRQRMRELEDLGVFNE    141 - 210
TEESNLNMYTRGKQKDIQRTDEETTDNQEGSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDD    211 - 280
EDEEDGEEENQKRYYLRQRKATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNR    281 - 350
RRHAIHSSDSTSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD    351 - 420
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKR    421 - 490
VAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMD    491 - 560
GLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAEN    561 - 630
CVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQA    631 - 700
LSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK    701 - 770
AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE    771 - 840
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQEL    841 - 910
FIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEE    911 - 980
QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYL    981 - 1050
RDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1051 - 1120
SYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDS   1121 - 1190
QNAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA   1191 - 1260
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVVDH   1261 - 1330
ERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR             1331 - 1390
//

Text Mined References (44)

PMID Year Title
26819280 2016 ATAD2 overexpression is associated with progression and prognosis in colorectal cancer.
26497681 2015 Suppression of ATAD2 inhibits hepatocellular carcinoma progression through activation of p53- and p38-mediated apoptotic signaling.
26308378 2015 ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.
25934333 2015 Overexpression of ANCCA/ATAD2 in endometrial carcinoma and its correlation with tumor progression and poor prognosis.
25813398 2015 Oncogene ATAD2 promotes cell proliferation, invasion and migration in cervical cancer.
25377252 2014 Lessons from yeast on emerging roles of the ATAD2 protein family in gene regulation and genome organization.
24805933 2014 Epigenetic high regulation of ATAD2 regulates the Hh pathway in human hepatocellular carcinoma.
24761900 2014 ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.
24552534 2014 miR-372 down-regulates the oncogene ATAD2 to influence hepatocellular carcinoma proliferation and metastasis.
24391143 2014 Kinesin family deregulation coordinated by bromodomain protein ANCCA and histone methyltransferase MLL for breast cancer cell growth, survival, and tamoxifen resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775406 2013 ANCCA protein expression is a novel independent poor prognostic marker in surgically resected lung adenocarcinoma.
23393560 2013 Integrated genomic analysis of the 8q24 amplification in endometrial cancers identifies ATAD2 as essential to MYC-dependent cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22914773 2012 A comparative and integrative approach identifies ATPase family, AAA domain containing 2 as a likely driver of cell proliferation in lung adenocarcinoma.
22771493 2012 Direct cooperation between androgen receptor and E2F1 reveals a common regulation mechanism for androgen-responsive genes in prostate cells.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20864510 2010 ANCCA/ATAD2 overexpression identifies breast cancer patients with poor prognosis, acting to drive proliferation and survival of triple-negative cells through control of B-Myb and EZH2.
20855524 2010 Chromatin loading of E2F-MLL complex by cancer-associated coregulator ANCCA via reading a specific histone mark.
20374707 2009 The roles and action mechanisms of p160/SRC coactivators and the ANCCA coregulator in cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19843847 2009 ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19318566 2009 Androgen-induced coactivator ANCCA mediates specific androgen receptor signaling in prostate cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998543 2007 ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17660802 2007 Prognostic significance of drug-regulated genes in high-grade osteosarcoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17076897 2006 A consensus prognostic gene expression classifier for ER positive breast cancer.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16709241 2006 Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery.
15721472 2005 Gene-expression profiles to predict distant metastasis of lymph-node-negative primary breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.