Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.35
PubTator Score 5.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.608 3.6e-03
psoriasis 1.600 2.3e-04
osteosarcoma 1.522 2.8e-03
glioblastoma 1.300 1.3e-02
medulloblastoma, large-cell 1.200 3.9e-03
non-small cell lung cancer 1.270 1.9e-21
lung cancer 2.400 9.5e-05
colon cancer 1.100 4.9e-04
sonic hedgehog group medulloblastoma 1.300 1.5e-04
nasopharyngeal carcinoma 1.200 3.0e-04
ovarian cancer 1.700 6.1e-03
dermatomyositis 1.200 6.1e-03

Gene RIF (2)

PMID Text
23904267 ASUN is identified as a functional component of Integrator (INT), a multisubunit complex required for 3'-end processing of small nuclear RNAs.
23097494 Data suggest that ASUN promotes perinuclear enrichment of dynein at G2/M that facilitates BICD2- and CENP-F-mediated anchoring of dynein to nuclear pore complexes.

AA Sequence

MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIF      1 - 70
PFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQ     71 - 140
HEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTY    141 - 210
PVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYD    211 - 280
VELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCL    281 - 350
TNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE    351 - 420
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEED    421 - 490
VLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMAC    491 - 560
RSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPP    561 - 630
NKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTEN    631 - 700
GKASRQ                                                                    701 - 706
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904267 2013 Nuclear-localized Asunder regulates cytoplasmic dynein localization via its role in the integrator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19357193 2009 Asunder is a critical regulator of dynein-dynactin localization during Drosophila spermatogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15737938 2005 Drosophila genome-scale screen for PAN GU kinase substrates identifies Mat89Bb as a cell cycle regulator.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414650 2002 Genomic and expression analysis of the 12p11-p12 amplicon using EST arrays identifies two novel amplified and overexpressed genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.