Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.94
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-03
astrocytoma 1.100 4.9e-02
atypical teratoid / rhabdoid tumor -4.200 5.8e-08
cutaneous lupus erythematosus -1.200 2.2e-02
ependymoma -1.600 1.5e-04
glioblastoma -1.500 2.7e-02
group 3 medulloblastoma -1.200 2.5e-02
invasive ductal carcinoma -1.258 3.4e-03
medulloblastoma, large-cell -3.400 2.6e-04
ovarian cancer -2.300 2.1e-16
Pick disease -1.300 2.2e-03
pituitary cancer 1.200 3.5e-03
primitive neuroectodermal tumor -1.100 2.5e-02
psoriasis -1.300 3.1e-02

Gene RIF (5)

AA Sequence

MALAGLCALLACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSV      1 - 70
RNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEP     71 - 140
QHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRWCKRRRVPQPQKSASAEAANEIHYIPSVLIG    141 - 210
GHGRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNE    211 - 280
KSGMDLTPGSDNAKLSLMNKYKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSG    281 - 350
TEAENDPQLTFYTDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCSSHVNCPLVVKITLHVPEHL    351 - 420
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETGRREHRAAGEC    421 - 490
LCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGMWLPLSKSFVI    491 - 560
PPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLEVLLDSFGPVRDCSKDNGGCSKNFRCISDRK    561 - 630
LDSTGCVCPSGLSPMKDSSGCYDRHIGVDCSDGFNGGCEQLCLQQMAPFPDDPTLYNILMFCGCIEDYKL    631 - 700
GVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQL    701 - 770
PDGLVVATVPLENQCLEEISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQVAISQALSNA    771 - 840
LHSLDGATSRADFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKGNSPSDESEERE    841 - 910
RDPKVLTFPEYITSLSDSGTKHMAAGVRMECHSKGRCPSSCPLCHVTSSPDTPAEPVLLEVTKAAPIYEL    911 - 980
VTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGADGLPTCAPLPQPVLRLSTVHEPSSTLVVLE    981 - 1050
WEHSEPPIGVQIVDYLLRQEKVTDRMDHSKVETETVLSFVDDIISGAKSPCAMPSQVPDKQLTTISLIIR   1051 - 1120
CLEPDTIYMFTLWGVDNTGRRSRPSDVIVKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLD   1121 - 1190
LGSPTLHRVLYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRSSLKYLG   1191 - 1260
CRYSEIKPYGLDWAELSRDLRKTCEEQTLSIPYNDYGDSKEI                               1261 - 1302
//

Text Mined References (14)

PMID Year Title