Property Summary

NCBI Gene PubMed Count 83
PubMed Score 186.05
PubTator Score 97.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Citrullinemia 14 0.0 5.0
Diabetic Angiopathies 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count
Citrullinemia type I 1

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.765 4.2e-03
active ulcerative colitis 1.967 5.0e-03
acute myeloid leukemia -1.600 4.5e-02
adult high grade glioma -1.100 1.8e-02
astrocytic glioma -2.200 4.5e-03
Astrocytoma, Pilocytic -1.600 1.8e-04
Barrett's esophagus 1.100 4.2e-02
Breast cancer 1.500 1.9e-04
cutaneous lupus erythematosus -1.700 3.7e-03
Duchenne muscular dystrophy 1.585 1.9e-10
esophageal adenocarcinoma 1.500 3.5e-02
fibroadenoma -1.200 3.3e-02
group 3 medulloblastoma 2.300 9.4e-04
interstitial cystitis -1.300 1.3e-03
intraductal papillary-mucinous carcinoma... 1.600 4.0e-03
intraductal papillary-mucinous neoplasm ... 1.900 5.7e-03
limb girdle muscular dystrophy 2B 1.261 2.0e-04
lung cancer 3.000 1.0e-03
malignant mesothelioma 2.000 1.6e-07
nasopharyngeal carcinoma -1.300 9.3e-03
nephrosclerosis -1.048 1.6e-02
oligodendroglioma -2.200 8.7e-03
ovarian cancer 1.500 1.6e-03
pancreatic cancer 1.300 4.0e-02
pituitary cancer -2.400 3.0e-08
posterior fossa group A ependymoma 1.600 1.3e-07
primary pancreatic ductal adenocarcinoma 1.661 1.8e-02
urothelial carcinoma -2.800 1.6e-02

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (50)

AA Sequence

MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE      1 - 70
EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK     71 - 140
VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT    141 - 210
QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG    211 - 280
IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ    281 - 350
VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK            351 - 412
//

Text Mined References (94)

PMID Year Title