Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1069.08
PubTator Score 1582.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 2.059 6.1e-04
active ulcerative colitis 1.697 2.0e-03
adult high grade glioma -1.600 8.1e-04
astrocytic glioma -1.700 3.4e-02
Astrocytoma, Pilocytic -1.300 8.3e-07
atypical teratoid / rhabdoid tumor -1.700 2.5e-07
ependymoma -2.000 4.0e-02
glioblastoma -1.100 2.4e-05
interstitial cystitis 1.200 4.5e-03
intraductal papillary-mucinous adenoma (... -1.100 4.2e-02
lung cancer -2.000 1.7e-03
malignant mesothelioma 3.000 3.1e-08
medulloblastoma -1.100 4.3e-05
medulloblastoma, large-cell -1.400 2.5e-04
non-small cell lung cancer -1.363 2.8e-12
osteosarcoma -2.106 3.8e-05
ovarian cancer 2.700 1.8e-06
psoriasis 1.300 4.5e-04
tuberculosis 1.600 2.3e-07

PDB (15)

Gene RIF (8)

AA Sequence

MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN      1 - 70
TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV     71 - 140
TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD    141 - 210
NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS    211 - 280
TSMPWAAAKDGKLHFGIDPDDTTITDLP                                              281 - 308
//

Text Mined References (21)

PMID Year Title