Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.200 2.9e-03
posterior fossa group B ependymoma -4.000 6.9e-20
oligodendroglioma -1.400 4.0e-02
glioblastoma -2.500 1.1e-05
osteosarcoma 1.423 1.9e-04
atypical teratoid / rhabdoid tumor -3.700 9.1e-12
medulloblastoma -1.100 1.4e-02
primitive neuroectodermal tumor -2.100 1.1e-03
pediatric high grade glioma -2.300 4.2e-07
pilocytic astrocytoma -2.800 7.5e-09
subependymal giant cell astrocytoma -2.222 1.7e-02
lung adenocarcinoma 2.100 8.4e-08
lung carcinoma 1.600 2.1e-35
psoriasis 1.100 3.7e-20

AA Sequence

MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGLLARASLIMLP      1 - 70
WPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPVGCSEAGGPSPGGPGDPGEGP     71 - 140
RTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPGVLGIQRPGLLFLPDLPSAPFVPRDAQRHDV    141 - 210
ELLESSFPAILRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRS    211 - 280
FMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHT    281 - 350
VAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVFAPDP                                  351 - 390
//

Text Mined References (8)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.