Property Summary

NCBI Gene PubMed Count 49
PubMed Score 231.73
PubTator Score 89.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.576 8.0e-03
malignant mesothelioma 2.100 2.4e-07
astrocytic glioma -1.100 3.9e-02
posterior fossa group B ependymoma -1.700 1.5e-06
esophageal adenocarcinoma 1.200 2.4e-02
cystic fibrosis -2.018 2.9e-04
atypical teratoid / rhabdoid tumor -1.100 7.5e-03
glioblastoma -1.200 8.4e-04
juvenile dermatomyositis 2.331 8.9e-12
adrenocortical carcinoma 1.521 1.0e-04
primary pancreatic ductal adenocarcinoma -3.426 5.0e-06
non-small cell lung cancer 1.784 4.3e-17
intraductal papillary-mucinous adenoma (... -1.100 4.7e-02
colon cancer 2.800 3.7e-02
lung cancer 1.500 6.7e-03
pilocytic astrocytoma -1.200 1.0e-04
MYELODYSPLASTIC SYNDROME -1.300 3.3e-02
nasopharyngeal carcinoma 1.400 1.3e-05
Polycystic Ovary Syndrome -1.906 3.7e-02
lung carcinoma 1.600 1.7e-17
Pick disease -2.100 3.5e-04
ovarian cancer 2.400 2.1e-05
pancreatic cancer -3.100 3.0e-05
dermatomyositis 1.200 3.5e-02

Protein-protein Interaction (1)

Gene RIF (29)

PMID Text
24913732 Data shows that high ASNS expression in NK/T cell lymphoma is correlated with worse clinicopathological features.
24907114 Polymorphisms of ASNS are associated with an increased risk of asparaginase-related complications in children with acute lymphoblastic leukemia.
24729124 ASNS deficiency is correlated with poor therapeutic response and worse survivals in patients with rectal cancer receiving neoadjuvant CCRT
24398846 cell differentiation was enhanced when asparagine in the culture media was depleted by an addition of L-asparaginase, indicating that downregulation of asparagine synthetase gene expression
24268318 A conditional interaction between the ASNS polymorphism and an early response to chemotherapy among pediatric patients with acute lymphoblastic leukemia.
24139043 study indicates that asparagine synthesis is essential for the development and function of the brain.
23956056 ASNS and MMP19, along with eIF3a, are the sensitivity factors for cisplatin treatment and may serve as potential candidate molecular markers for predicting cisplatin sensitivity of advanced nasopharyngeal carcinoma.
23764751 expression of ASNS was higher in hepatocellular carcinoma tissues; expression of ASNS is an independent factor affecting the survival of HCC patients, and low ASNS expression in HCC was correlated with worse surgical outcomes
23403946 Identifying the roles of ASNS in fetal development, tissue differentiation, and tumor growth may reveal that ASNS function extends beyond asparagine biosynthesis.
22978410 Activation of asparagine synthetase by amino acid limitation results in dynamic changes in genomic histone association.
21505976 Subcellular translocation of asparagine synthetase may play an important role in L-asparaginase resistance in leukemia cells.
20561401 AsnS mRNA expression level in tumor cells reflects the sensitivity of cells to L-asparaginase.
19414379 Declined asparagine synthetase mRNA expression and enhanced sensitivity to asparaginase in HL-60 cells committed to monocytic differentiation.
19054556 DNA polymorphism of a tandem repeated sequence is associated with the asparagine synthetase gene in acute lymphoblastic leukemia
19035175 High expression of asparagine synthetase is associated with a poor outcome in ALL children.
18940792 CHOP is a member of the transcription factor network that controls the stress-induced regulation of specific C/EBP-ATF4-containing genes, such as ASNS
18852115 These findings provide rationale for evaluation of ASNS protein expression as a predictive biomarker of clinical L-ASP activity in ovarian cancer.
18852115 ASNS protein expression predicts L-asparaginase chemotherapeutic activity in a large, diverse set of ovarian cancer cell lines.
18840095 ASNS (asparagine synthetase) transcription activity was up-regulated in HepG2 cells treated with the UPR activators thapsigargin and tunicamycin
17380207 RNA interference decreases capacity of mesenchymal stem cells to protect acute lymphoblastic leukemia cells from asparaginase, whereas enforced ASNS expression conferred enhanced protection.
17276738 results suggest that the presence of MELAS and NARP mtDNA mutations elicits upregulation of CHOP and ASNS genes through the elevation of ATF4 expression and its binding to the amino acid regulatory element and nutrient-sensing response element-1
17088436 ASNS RNAi potentiates L-asparaginase chemotherapeutic activity in ovarian cancer cell lines from the NCI-60, and ASNS mRNA expression predicts L-asparaginase activity in the ovarian subpanel of the NCI-60.
16598302 coorelation between methylation of ASNS and acute lymphoblastic leukemia
15674423 The Asparagine Synthetase), which is a housekeeping gene, is repressed and the promoting region of the gene is highly methylated.
15385533 ATF3-FL and C/EBPbeta act as transcriptional suppressors for the ASNS gene to counterbalance the transcription rate activated by ATF4 following amino acid deprivation
12351626 documentation of the comparison between CHOP and AS transcriptional control elements used by the amino acid pathway
12097650 Genomic sequences necessary for transcriptional activation by amino acid deprivation of mammalian cells. activation of asparagine synthetase gene by endoplasmic reticulum stress.
11960987 ATF4 is a mediator of the nutrient-sensing response pathway that activates asparagine synthetase gene
11867623 Role of Sp1 and Sp3 in the nutrient-regulated expression of the human asparagine synthetase gene

AA Sequence

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL      1 - 70
WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY     71 - 140
GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV    141 - 210
PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ    211 - 280
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK    281 - 350
YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF    351 - 420
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE    421 - 490
HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK    491 - 560
A//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24913732 2014 Asparagine synthetase expression and its potential prognostic value in patients with NK/T cell lymphoma.
24907114 2015 Polymorphisms of asparaginase pathway and asparaginase-related complications in children with acute lymphoblastic leukemia.
24729124 2014 Deficiency in asparagine synthetase expression in rectal cancers receiving concurrent chemoradiotherapy: negative prognostic impact and therapeutic relevance.
24398846 2014 Analysis of gene profiles involved in the enhancement of all-trans retinoic acid-induced HL-60 cell differentiation by sesquiterpene lactones identifies asparagine synthetase as a novel target for differentiation-inducing therapy.
24268318 2014 Asparagine synthetase (ASNS) gene polymorphism is associated with the outcome of childhood acute lymphoblastic leukemia by affecting early response to treatment.
24139043 2013 Deficiency of asparagine synthetase causes congenital microcephaly and a progressive form of encephalopathy.
23956056 2013 Overexpression of asparagine synthetase and matrix metalloproteinase 19 confers cisplatin sensitivity in nasopharyngeal carcinoma cells.
23764751 2013 Asparagine synthetase is an independent predictor of surgical survival and a potential therapeutic target in hepatocellular carcinoma.
23403946 2013 Asparagine synthetase: regulation by cell stress and involvement in tumor biology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22978410 2013 Dynamic changes in genomic histone association and modification during activation of the ASNS and ATF3 genes by amino acid limitation.
21505976 2011 Asparagine synthetase is partially localized to the plasma membrane and upregulated by L-asparaginase in U937 cells.
21269460 2011 Initial characterization of the human central proteome.
20561401 2010 [Relationship between asparagine synthetase expression level and cell sensitivity to L-asparaginase in human leukemic cell lines].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19414379 2009 Declined asparagine synthetase mRNA expression and enhanced sensitivity to asparaginase in HL-60 cells committed to monocytic differentiation.
19054556 2009 Functional analysis of a novel DNA polymorphism of a tandem repeated sequence in the asparagine synthetase gene in acute lymphoblastic leukemia cells.
19035175 2008 [Study of the correlation between the expression level of asparagine synthetase and the outcome of children with acute lymphocytic leukemia].
18940792 2008 C/EBP homology protein (CHOP) interacts with activating transcription factor 4 (ATF4) and negatively regulates the stress-dependent induction of the asparagine synthetase gene.
18852115 2008 Asparagine synthetase is a predictive biomarker of L-asparaginase activity in ovarian cancer cell lines.
18840095 2009 Transcriptional induction of the human asparagine synthetase gene during the unfolded protein response does not require the ATF6 and IRE1/XBP1 arms of the pathway.
17409444 2007 Enhanced expression of asparagine synthetase under glucose-deprived conditions protects pancreatic cancer cells from apoptosis induced by glucose deprivation and cisplatin.
17380207 2007 Mesenchymal cells regulate the response of acute lymphoblastic leukemia cells to asparaginase.
17276738 CHOP (C/EBP homologous protein) and ASNS (asparagine synthetase) induction in cybrid cells harboring MELAS and NARP mitochondrial DNA mutations.
17088436 2006 Asparagine synthetase as a causal, predictive biomarker for L-asparaginase activity in ovarian cancer cells.
16598302 2006 Methylation analysis of asparagine synthetase gene in acute lymphoblastic leukemia cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16023613 2005 Efficient expression, purification, and characterization of C-terminally tagged, recombinant human asparagine synthetase.
15674423 2005 Epigenetic changes in the repression and induction of asparagine synthetase in human leukemic cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385533 2004 Amino acid deprivation induces the transcription rate of the human asparagine synthetase gene through a timed program of expression and promoter binding of nutrient-responsive basic region/leucine zipper transcription factors as well as localized histone acetylation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949534 2003 Impaired feedback regulation of XBP1 as a genetic risk factor for bipolar disorder.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351626 2002 Differences in the molecular mechanisms involved in the transcriptional activation of the CHOP and asparagine synthetase genes in response to amino acid deprivation or activation of the unfolded protein response.
12097650 2002 Genomic sequences necessary for transcriptional activation by amino acid deprivation of mammalian cells.
11960987 2002 ATF4 is a mediator of the nutrient-sensing response pathway that activates the human asparagine synthetase gene.
11867623 2002 Role of Sp1 and Sp3 in the nutrient-regulated expression of the human asparagine synthetase gene.
10085239 1999 Transcriptional regulation of the human asparagine synthetase gene by carbohydrate availability.
9847074 1998 Toward a complete human genome sequence.
8093451 1993 Interaction of the eucaryotic peptide chain initiation factor eIF-4A with the specific elements at the 5'-untranslated sequence of human asparagine synthetase mRNA.
7904551 1994 Refined localization of the asparagine synthetase gene (ASNS) to chromosome 7, region q21.3, and characterization of the somatic cell hybrid line 4AF/106/KO15.
6137879 1983 Assignment of structural gene for asparagine synthetase to human chromosome 7.
3470743 1987 Molecular cloning of a gene that is necessary for G1 progression in mammalian cells.
2886907 1987 Isolation of human cDNAs for asparagine synthetase and expression in Jensen rat sarcoma cells.
2714790 1989 Chromosomal localization of human genes required for G1 progression in mammalian cells.
2573597 1989 The N-terminal cysteine of human asparagine synthetase is essential for glutamine-dependent activity.
2569668 1989 Organization and expression of the cell cycle gene, ts11, that encodes asparagine synthetase.
2565875 1989 Molecular structure of the human asparagine synthetase gene.
2564390 1989 Expression of human asparagine synthetase in Escherichia coli.