Property Summary

NCBI Gene PubMed Count 25
PubMed Score 72.31
PubTator Score 43.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.100 1.8e-02
pancreatic cancer -1.100 2.2e-02
Multiple myeloma 1.149 4.2e-04
psoriasis 1.400 8.5e-05
lung cancer 1.200 8.3e-03
pancreatic carcinoma -1.100 2.2e-02
ovarian cancer 1.700 4.6e-04

Gene RIF (14)

PMID Text
26675233 Emerin interacts with TRC40 in situ.
24885147 The repertoire of VAPB interactors is more diverse than previously anticipated and link VAPB to the function of ATPase complexes such as p97/FAF1 and ASNA1/transmembrane-domain recognition complex.
23460677 PEX19 formed a complex with the peroxisomal tail anchored protein PEX26 in the cytosol and translocated it directly to peroxisomes by a TRC40-independent class I pathway.
23166591 Expression of HIV-1 Tat upregulates the abundance of arsA arsenite transporter, ATP-binding, homolog 1 (ASNA1) in the nucleoli of Jurkat T-cells
23041287 Results indicate calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex and a crucial mechanism for driving ER membrane insertion of TA proteins in mammalian cells.
22505607 Proteins bind to TRC40 and can utilise this component for their delivery to the ER membrane.
21878631 Post-translational membrane insertion of tail-anchored transmembrane EF-hand Ca2+ sensor calneurons requires the TRC40/Asna1 protein chaperone.
21444755 The coiled-coil domain of WRB is the binding site for TRC40/Asna1.
21296983 Asna1 is required for efficient histocompatibility (HLA) class I downregulation mediated by viral protein BNLF2a.
20375064 Asna1 can mediate membrane insertion of RAMP4 and Sec61beta without the participation of other cytosolic proteins by a mechanism that depends on the presence of ATP or ADP and a protease-sensitive receptor in the endoplasmic reticulum membrane.
19724867 ASNA1 is a target to overcome platinum resistance in ovarian cancer
18667436 the hydrophobicity of the TA region dictates whether a precursor is delivered to the ER via the Hsp40/Hsc70 or Asna-1/TRC40-dependent route.
17382883 TRC40/Asna-1 interacts posttranslationally with tail-anchored proteins in a transmembrane domain-dependent manner for delivery to a proteinaceous receptor at the endoplasmic reticulum membrane.
17289575 Human ASNA1 is highly expressed in pancreatic beta cells, but not in other pancreatic endocrine cell types, and regulates insulin secretion in cultured cells.

AA Sequence

MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLI      1 - 70
ISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFP     71 - 140
GIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGL    141 - 210
GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQL    211 - 280
VFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ      281 - 348
//

Text Mined References (32)

PMID Year Title
26675233 2016 Emery-Dreifuss muscular dystrophy mutations impair TRC40-mediated targeting of emerin to the inner nuclear membrane.
25416956 2014 A proteome-scale map of the human interactome network.
24885147 2014 VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23460677 2013 Tail-anchored PEX26 targets peroxisomes via a PEX19-dependent and TRC40-independent class I pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23041287 2012 Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.
22505607 2012 TRC40 can deliver short secretory proteins to the Sec61 translocon.
21878631 2011 Post-translational membrane insertion of tail-anchored transmembrane EF-hand Ca2+ sensor calneurons requires the TRC40/Asna1 protein chaperone.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21444755 2011 WRB is the receptor for TRC40/Asna1-mediated insertion of tail-anchored proteins into the ER membrane.
21296983 2011 EBV protein BNLF2a exploits host tail-anchored protein integration machinery to inhibit TAP.
21269460 2011 Initial characterization of the human central proteome.
20375064 2010 Asna1/TRC40-mediated membrane insertion of tail-anchored proteins.
19724867 2009 Increased sensitivity to platinating agents and arsenite in human ovarian cancer by downregulation of ASNA1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18667436 2008 A precursor-specific role for Hsp40/Hsc70 during tail-anchored protein integration at the endoplasmic reticulum.
18477612 2008 Distinct targeting pathways for the membrane insertion of tail-anchored (TA) proteins.
17382883 2007 Identification of a targeting factor for posttranslational membrane protein insertion into the ER.
17289575 2007 ASNA-1 positively regulates insulin secretion in C. elegans and mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10696239 1998 Chromosomal localization and genomic structure of the human arsenite-stimulated ATPase (hASNA-I).
9774623 1998 Immunohistochemical analysis of the distribution of the human ATPase (hASNA-I) in normal tissues and its overexpression in breast adenomas and carcinomas.
9736449 1998 Dual cytoplasmic and nuclear distribution of the novel arsenite-stimulated human ATPase (hASNA-I).
9712828 1998 Biochemical characterization of the human arsenite-stimulated ATPase (hASNA-I).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8884272 1996 Isolation of the ATP-binding human homolog of the arsA component of the bacterial arsenite transporter.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.