Property Summary

NCBI Gene PubMed Count 36
PubMed Score 130.77
PubTator Score 231.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

AA Sequence

MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV      1 - 70
AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI     71 - 140
RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG    141 - 210
VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG    211 - 280
SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI    281 - 350
STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF    351 - 420
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA                              421 - 464
//

Text Mined References (39)

PMID Year Title