Property Summary

NCBI Gene PubMed Count 40
PubMed Score 57.19
PubTator Score 58.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 3.51 1.8
Carcinoma, Basal Cell 28 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Disease Target Count
Basal cell carcinoma 54
Disease Target Count P-value
psoriasis 6694 3.0e-44
ovarian cancer 8520 1.5e-11
Disease Target Count Z-score Confidence
Obesity 678 3.181 1.6
Vitiligo 73 3.016 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 1.5e-11
psoriasis -1.700 3.0e-44

Gene RIF (35)

AA Sequence

MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK      1 - 70
RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC             71 - 132
//

Text Mined References (41)

PMID Year Title