Property Summary

NCBI Gene PubMed Count 36
PubMed Score 239.84
PubTator Score 67.22

Knowledge Summary

Patent (25,126)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 3.5e-03
posterior fossa group A ependymoma -2.300 1.5e-19
oligodendroglioma -1.400 2.8e-03
glioblastoma -1.900 9.5e-10
sonic hedgehog group medulloblastoma -2.100 1.2e-06
atypical teratoid/rhabdoid tumor -2.000 6.4e-13
medulloblastoma, large-cell -1.100 1.3e-02
primitive neuroectodermal tumor -1.900 2.0e-05
pediatric high grade glioma -2.000 3.1e-10
subependymal giant cell astrocytoma -1.023 4.8e-02
psoriasis -1.500 2.8e-20

Gene RIF (19)

PMID Text
26617738 results demonstrate the occurrence of ASIC2 and TrkB in the human intervertebral disc (IVD), and the increased expression of both in pathological IVD suggest their involvement in IVD degeneration
26033064 This study suggests that ASIC2 may play a role as mediators of inflammatory pain and be involved in the pathogenesis of frozen shoulder.
25224144 distribution of ASIC2 in the human cutaneous mechanosensory system and suggest the involvement of ASIC2 in mechanosensation
24847067 Combinatorial analysis suggests a model of random mixing of ASIC1a and ASIC2a subunits to yield both 2:1 and 1:2 ASIC1a:ASIC2a heteromers together with ASIC1a and ASIC2a homomers.
22157923 The results showed that there was a significant increase in the mean relative optical density of ASIC2 and ASIC3 but not ASIC1a in the lining epithelium and glandular tubes of gastric mucosa in patients with Henoch-Schonlein purpura.
21961650 these results indicate that ACCN1 gene is a potential candidate for response to lithium treatment that would serve as a genetic marker of lithium efficacy for bipolar disorder patients.
21811305 ACCN1 might be one of numerous susceptibility genes for panic disorder.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306292 These results demonstrate for the first time the differential distribution of ASIC1 and ASIC2 in human rapidly adapting low-threshold mechanoreceptors, and suggest specific roles of both proteins in mechanotransduction.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19091960 Two PKC consensus sites on human acid-sensing ion channel 1b differentially regulate its function.
17553932 This work provides a mechanism explaining how defects in parkin-mediated PICK1 monoubiquitination could enhance ASIC activity and thereby promote neurodegeneration in Parkinson's disease.
17548344 AKAP150 and the protein phosphatase calcineurin are binding proteins to ASIC2a, and calcineurin regulates ASIC1a and ASIC2a activity
17534430 Application of these methods allowed us to find a significant association between MS and the SNP rs28936 located in the 3' UTR segment of ACCN1 with p = 0.0004 (p = 0.002, after adjusting for multiple testing)
17534430 Observational study of gene-disease association. (HuGE Navigator)
17376794 Observational study of gene-disease association. (HuGE Navigator)
16704974 ASIC2 surface expression inhibits the amiloride-sensitive current and migration of glioma cells
15504740 the ASIC2a subtype consists of intracellular amino and carboxyl termini and two transmembrane domains connected by a large extracellular loop

AA Sequence

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY      1 - 70
QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK     71 - 140
ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK    141 - 210
GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT    211 - 280
YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL    281 - 350
AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK    351 - 420
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE    421 - 490
TISHTVNVPLQTTLGTLEEIAC                                                    491 - 512
//

Text Mined References (38)

PMID Year Title
26617738 2015 Acid-sensing ion channel 2 (asic 2) and trkb interrelationships within the intervertebral disc.
26033064 2015 Up-regulation of acid-sensing ion channels in the capsule of the joint in frozen shoulder.
25224144 2015 ASIC2 is present in human mechanosensory neurons of the dorsal root ganglia and in mechanoreceptors of the glabrous skin.
24847067 2014 Acid-sensing ion channel (ASIC) 1a/2a heteromers have a flexible 2:1/1:2 stoichiometry.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22157923 2012 Expression of acid-sensing ion channels of gastric mucosa from patients with Henoch-Schönlein purpura.
21961650 2011 Evidence for association of an ACCN1 gene variant with response to lithium treatment in Sardinian patients with bipolar disorder.
21811305 2012 A genome-wide study of panic disorder suggests the amiloride-sensitive cation channel 1 as a candidate gene.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306292 2010 Differential localization of Acid-sensing ion channels 1 and 2 in human cutaneus pacinian corpuscles.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19812697 2009 Sour ageusia in two individuals implicates ion channels of the ASIC and PKD families in human sour taste perception at the anterior tongue.
19091960 2009 Two PKC consensus sites on human acid-sensing ion channel 1b differentially regulate its function.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17553932 2007 Parkin-mediated monoubiquitination of the PDZ protein PICK1 regulates the activity of acid-sensing ion channels.
17548344 2007 A kinase-anchoring protein 150 and calcineurin are involved in regulation of acid-sensing ion channels ASIC1a and ASIC2a.
17534430 2007 Association between the ACCN1 gene and multiple sclerosis in Central East Sardinia.
17376794 2007 High density SNP association study of a major autism linkage region on chromosome 17.
16704974 2006 Surface expression of ASIC2 inhibits the amiloride-sensitive current and migration of glioma cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15504740 2004 Analysis of the membrane topology of the acid-sensing ion channel 2a.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471860 2004 Stomatin modulates gating of acid-sensing ion channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11802773 2002 Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel).
11739374 2002 The PDZ domain protein PICK1 and the sodium channel BNaC1 interact and localize at mechanosensory terminals of dorsal root ganglion neurons and dendrites of central neurons.
10842183 2000 Mammalian ASIC2a and ASIC3 subunits co-assemble into heteromeric proton-gated channels sensitive to Gd3+.
9360943 1997 The acid-sensitive ionic channel subunit ASIC and the mammalian degenerin MDEG form a heteromultimeric H+-gated Na+ channel with novel properties.
9037075 1997 BNaC1 and BNaC2 constitute a new family of human neuronal sodium channels related to degenerins and epithelial sodium channels.
8921408 1996 The human degenerin MDEG, an amiloride-sensitive neuronal cation channel, is localized on chromosome 17q11.2-17q12 close to the microsatellite D17S798.
8631835 1996 The mammalian degenerin MDEG, an amiloride-sensitive cation channel activated by mutations causing neurodegeneration in Caenorhabditis elegans.
8626462 1996 Cloning and expression of a novel human brain Na+ channel.