Property Summary

Ligand Count 4
NCBI Gene PubMed Count 39
PubMed Score 295.79
PubTator Score 67.22

Knowledge Summary

Patent (25,126)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.000 6.7e-08
astrocytic glioma -1.300 3.5e-03
atypical teratoid / rhabdoid tumor -1.900 2.0e-10
ependymoma -1.500 1.4e-03
glioblastoma -1.900 9.5e-10
group 3 medulloblastoma -1.600 8.6e-04
medulloblastoma, large-cell -1.100 1.3e-02
oligodendroglioma -1.400 2.8e-03
primitive neuroectodermal tumor -1.900 2.0e-05
psoriasis -1.500 2.8e-20
subependymal giant cell astrocytoma -1.023 4.8e-02

Gene RIF (22)

AA Sequence

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY      1 - 70
QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK     71 - 140
ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK    141 - 210
GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT    211 - 280
YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL    281 - 350
AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK    351 - 420
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE    421 - 490
TISHTVNVPLQTTLGTLEEIAC                                                    491 - 512
//

Text Mined References (42)

PMID Year Title