Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.89
PubTator Score 10.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 5.1e-04
pancreatic cancer 2300 1.5e-03
pancreatic carcinoma 567 1.5e-03
osteosarcoma 7933 2.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.100 1.5e-03
osteosarcoma -1.215 2.1e-03
pancreatic carcinoma 1.100 1.5e-03
ovarian cancer -1.100 5.1e-04

Gene RIF (8)

PMID Text
23604802 the distribution of ASGR in human testis, was investigated.
22096539 sH2a has the potential to be a uniquely sensitive and specific novel marker for liver fibrosis and function.
21656538 found that the asialoglycoprotein receptor (ASGPR) is involved in hepatocyte recognition of cells predestined for killing, including activated autologous T lymphocytes
20237496 Observational study of gene-disease association. (HuGE Navigator)
19520807 Exposure of beta-galactose results in the rapid clearance of platelets from the circulation by asialoglycoprotein receptor-expressing liver macrophages and hepatocytes.
12119473 primary renal proximal tubular epithelial cells have a functional ASGPR, consisting of the H1 and H2 subunits, that is capable of specific ligand binding and uptake
12089159 trafficks intracellularly and forms homo-oligomers, but does not bind asialo-orosomucoid
11943787 The minor subunit splice variants, H2b and H2c, of the human asialoglycoprotein receptor are present with the major subunit H1 in different hetero-oligomeric receptor complexes

AA Sequence

MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILL      1 - 70
LVVICVTGSQSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLK     71 - 140
ADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENA    141 - 210
HLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVE    211 - 280
VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA                                           281 - 311
//

Text Mined References (39)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23604802 2013 Expression pattern of asialoglycoprotein receptor in human testis.
22096539 2011 A secreted form of the asialoglycoprotein receptor, sH2a, as a novel potential noninvasive marker for liver fibrosis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21656538 2011 Hepatocyte cytotoxicity is facilitated by asialoglycoprotein receptor.
21207081 2011 Asialoglycoprotein receptor interacts with the preS1 domain of hepatitis B virus in vivo and in vitro.
21063834 2010 Establishment of a functional cell line expressing both subunits of H1a and H2c of human hepatocyte surface molecule ASGPR.
20703846 2010 Preoperative estimation of asialoglycoprotein receptor expression in the remnant liver from CT/99mTc-GSA SPECT fusion images correlates well with postoperative liver function parameters.
20364278 2010 Fibronectin and asialoglyprotein receptor mediate hepatitis B surface antigen binding to the cell surface.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19663694 2009 An internalizing antibody specific for the human asialoglycoprotein receptor.
19576873 2009 Autoantibodies to asialoglycoprotein receptor (ASGPR) measured by a novel ELISA--revival of a disease-activity marker in autoimmune hepatitis.
19520807 2009 Role of sialic acid for platelet life span: exposure of beta-galactose results in the rapid clearance of platelets from the circulation by asialoglycoprotein receptor-expressing liver macrophages and hepatocytes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18855599 2008 Targeted delivery of macromolecular drugs: asialoglycoprotein receptor (ASGPR) expression by selected hepatoma cell lines used in antiviral drug development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15946216 2005 The B domain of coagulation factor VIII interacts with the asialoglycoprotein receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477859 2003 Role of the asialoglycoprotein receptor in binding and entry of hepatitis C virus structural proteins in cultured human hepatocytes.
12359251 2002 Palmitoylation-defective asialoglycoprotein receptors are normal in their cellular distribution and ability to bind ligand, but are defective in ligand uptake and degradation.
12171918 2002 Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.
12167617 2002 Phosphorylation-dependent interaction of the asialoglycoprotein receptor with molecular chaperones.
12119473 2002 Expression of a functional asialoglycoprotein receptor in human renal proximal tubular epithelial cells.
12089159 2002 H2, the minor subunit of the human asialoglycoprotein receptor, trafficks intracellularly and forms homo-oligomers, but does not bind asialo-orosomucoid.
11943787 2002 The minor subunit splice variants, H2b and H2c, of the human asialoglycoprotein receptor are present with the major subunit H1 in different hetero-oligomeric receptor complexes.
11543633 2001 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.
10859341 2000 The N-glycans determine the differential blood clearance and hepatic uptake of human immunoglobulin (Ig)A1 and IgA2 isotypes.
9349295 1997 Receptor-mediated entry of hepatitis B virus particles into liver cells.
8397210 1993 The secretory pathway is normal in dithiothreitol-treated cells, but disulfide-bonded proteins are reduced and reversibly retained in the endoplasmic reticulum.
7844558 1995 The asialoglycoprotein receptor is a potential liver-specific receptor for Marburg virus.
7843709 1995 Detection and quantification of soluble asialoglycoprotein receptor in human serum.
3863106 1985 Sequence of a second human asialoglycoprotein receptor: conservation of two receptor genes during evolution.
2834401 1988 The H1 and H2 polypeptides associate to form the asialoglycoprotein receptor in human hepatoma cells.
1924301 1991 Endocytosis by the asialoglycoprotein receptor is independent of cytoplasmic serine residues.
1597447 1992 Alternatively spliced variants of the human hepatic asialoglycoprotein receptor, H2, differ in cellular trafficking and regulation of phosphorylation.
1371982 1992 Differences in the abundance of variably spliced transcripts for the second asialoglycoprotein receptor polypeptide, H2, in normal and transformed human liver.