Property Summary

NCBI Gene PubMed Count 46
PubMed Score 338.15
PubTator Score 223.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.285 5.4e-08
glioblastoma -1.100 5.8e-03
medulloblastoma, large-cell -1.700 2.8e-05
tuberculosis 2.100 8.3e-07
lung cancer -1.300 1.5e-03
adult high grade glioma -1.200 6.7e-03

Protein-protein Interaction (4)

Gene RIF (20)

PMID Text
27192541 ASGR1 haploinsufficiency was associated with reduced levels of non-HDL cholesterol and a reduced risk of coronary artery disease.
25485912 Endocytic AMR controls TPO expression through Janus kinase 2 (JAK2) and the acute phase response signal transducer and activator of transcription 3 (STAT3) in vivo and in vitro
25404440 Flow cytometric assessment of ASGPR expression may be a useful predictor of liver dysfunction following major hepatectomy for HCC in Chinese patients.
24933948 Anti-ASGPR levels correlate with biochemical parameters and with the severity and manifestation autoimmune processes in patients with autoimmune hepatitis.
24763545 Anti-ASGPR antibody could be used for specific and efficient HCC CTC enrichment, and anti-P-CK combined with anti-CPS1 antibodies is superior to identification with one antibody alone in the sensitivity for HCC CTC detection.
23979840 The examined ASGPR1 expression levels by immunohistochemistry in HCC with different grades. Guidance for a targeting delivery strategy for anti-cancer drugs to HCC is suggested in this report.
23604802 the distribution of ASGR in human testis, was investigated.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of asialoglycoprotein receptor 1 (ASGR1) in peptide-treated PBMCs
22613667 the cooperative binding mode of Ca(2+) makes it possible for ASGP-R to be more sensitive to Ca(2+) concentrations in early endosomes, and plays an important role in the efficient release of ligand from ASGP-R
22219600 Constant sH2a levels suggest constitutive secretion from hepatocytes in healthy individuals; therefore, a decrease with cirrhosis suggests a diagnostic potential.
21656538 found that the asialoglycoprotein receptor (ASGPR) is involved in hepatocyte recognition of cells predestined for killing, including activated autologous T lymphocytes
21207081 Asialoglycoprotein receptor (ASGPR) interacted specifically and directly with the preS1 domain of HBV in vivo and in vitro.
20886072 Two naturally occurring ASGPR1 splice variants are produced in human hepatocytes.
20364278 our findings suggest that both fibronectin and ASGPR mediate HBsAg binding to the cell surface, which provides further evidence for the potential roles of these two proteins in mediating HBV binding to liver cells.
19520807 Exposure of beta-galactose results in the rapid clearance of platelets from the circulation by asialoglycoprotein receptor-expressing liver macrophages and hepatocytes.
12370180 the spacing of a Cys residue relative to the TMD in the primary protein sequence of H1 is the major determinant for successful palmitoylation
12359251 the effects of palmitoylation on ASGP-R activity and function
12167617 Phosphorylation-dependent interaction with molecular chaperones
12119473 primary renal proximal tubular epithelial cells have a functional ASGPR, consisting of the H1 and H2 subunits, that is capable of specific ligand binding and uptake
11943787 The minor subunit splice variants, H2b and H2c, of the human asialoglycoprotein receptor are present with the major subunit H1 in different hetero-oligomeric receptor complexes

AA Sequence

MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL      1 - 70
RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ     71 - 140
MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT    141 - 210
WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE    211 - 280
LDKASQEPPLL                                                               281 - 291
//

Text Mined References (52)

PMID Year Title
27192541 2016 Variant ASGR1 Associated with a Reduced Risk of Coronary Artery Disease.
25485912 2015 The Ashwell-Morell receptor regulates hepatic thrombopoietin production via JAK2-STAT3 signaling.
25404440 2014 Flow cytometric analysis of asialoglycoprotein receptor expression predicts hepatic functional reserve after hepatectomy.
24933948 2013 [Diagnostic value of autoantibodies to asialoglycoprotein receptor in autoimmune hepatitis].
24763545 2014 Detection of circulating tumor cells in hepatocellular carcinoma using antibodies against asialoglycoprotein receptor, carbamoyl phosphate synthetase 1 and pan-cytokeratin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979840 2013 Expression of asialoglycoprotein receptor 1 in human hepatocellular carcinoma.
23604802 2013 Expression pattern of asialoglycoprotein receptor in human testis.
22613667 2012 NMR study of ligand release from asialoglycoprotein receptor under solution conditions in early endosomes.
22219600 2011 Constant serum levels of secreted asialoglycoprotein receptor sH2a and decrease with cirrhosis.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21656538 2011 Hepatocyte cytotoxicity is facilitated by asialoglycoprotein receptor.
21269460 2011 Initial characterization of the human central proteome.
21207081 2011 Asialoglycoprotein receptor interacts with the preS1 domain of hepatitis B virus in vivo and in vitro.
21063834 2010 Establishment of a functional cell line expressing both subunits of H1a and H2c of human hepatocyte surface molecule ASGPR.
20886072 2010 A new splice variant of the major subunit of human asialoglycoprotein receptor encodes a secreted form in hepatocytes.
20703846 2010 Preoperative estimation of asialoglycoprotein receptor expression in the remnant liver from CT/99mTc-GSA SPECT fusion images correlates well with postoperative liver function parameters.
20364278 2010 Fibronectin and asialoglyprotein receptor mediate hepatitis B surface antigen binding to the cell surface.
19725223 2009 Potentiation of proliferation of some but not all human colon carcinoma cell lines by immobilized hepatic asialoglycoprotein receptor 1.
19663694 2009 An internalizing antibody specific for the human asialoglycoprotein receptor.
19576873 2009 Autoantibodies to asialoglycoprotein receptor (ASGPR) measured by a novel ELISA--revival of a disease-activity marker in autoimmune hepatitis.
19520807 2009 Role of sialic acid for platelet life span: exposure of beta-galactose results in the rapid clearance of platelets from the circulation by asialoglycoprotein receptor-expressing liver macrophages and hepatocytes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18855599 2008 Targeted delivery of macromolecular drugs: asialoglycoprotein receptor (ASGPR) expression by selected hepatoma cell lines used in antiviral drug development.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16475991 2006 Antisense oligonucleotides targeted against asialoglycoprotein receptor 1 block human hepatitis B virus replication.
16341674 2005 Transcriptome analysis of human gastric cancer.
15946216 2005 The B domain of coagulation factor VIII interacts with the asialoglycoprotein receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477859 2003 Role of the asialoglycoprotein receptor in binding and entry of hepatitis C virus structural proteins in cultured human hepatocytes.
12370180 2002 The position of cysteine relative to the transmembrane domain is critical for palmitoylation of H1, the major subunit of the human asialoglycoprotein receptor.
12359251 2002 Palmitoylation-defective asialoglycoprotein receptors are normal in their cellular distribution and ability to bind ligand, but are defective in ligand uptake and degradation.
12171918 2002 Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.
12167617 2002 Phosphorylation-dependent interaction of the asialoglycoprotein receptor with molecular chaperones.
12119473 2002 Expression of a functional asialoglycoprotein receptor in human renal proximal tubular epithelial cells.
11943787 2002 The minor subunit splice variants, H2b and H2c, of the human asialoglycoprotein receptor are present with the major subunit H1 in different hetero-oligomeric receptor complexes.
11543633 2001 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.
10891274 2000 Crystal structure of the carbohydrate recognition domain of the H1 subunit of the asialoglycoprotein receptor.
10859341 2000 The N-glycans determine the differential blood clearance and hepatic uptake of human immunoglobulin (Ig)A1 and IgA2 isotypes.
10734069 2000 Basolateral sorting signals differ in their ability to redirect apical proteins to the basolateral cell surface.
9349295 1997 Receptor-mediated entry of hepatitis B virus particles into liver cells.
8943311 1996 Fatty acylation of the rat and human asialoglycoprotein receptors. A conserved cytoplasmic cysteine residue is acylated in all receptor subunits.
7844558 1995 The asialoglycoprotein receptor is a potential liver-specific receptor for Marburg virus.
7843709 1995 Detection and quantification of soluble asialoglycoprotein receptor in human serum.
3753585 1986 An internal signal sequence: the asialoglycoprotein receptor membrane anchor.
2982798 1985 Sequence of human asialoglycoprotein receptor cDNA. An internal signal sequence for membrane insertion.
2834401 1988 The H1 and H2 polypeptides associate to form the asialoglycoprotein receptor in human hepatoma cells.
1935897 1991 In vitro binding of the asialoglycoprotein receptor to the beta adaptin of plasma membrane coated vesicles.
1924301 1991 Endocytosis by the asialoglycoprotein receptor is independent of cytoplasmic serine residues.
1774077 1991 Assignment of human asialoglycoprotein receptor gene (ASGR1) to chromosome 17p11-13.