Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.37
PubTator Score 13.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.300 7.7e-08
osteosarcoma -1.674 1.2e-03
glioblastoma 2.200 2.9e-06
medulloblastoma 2.000 1.3e-09
atypical teratoid / rhabdoid tumor 2.200 1.9e-09
medulloblastoma, large-cell 2.000 3.2e-06
primitive neuroectodermal tumor 1.600 5.7e-05
adrenocortical carcinoma 1.918 1.7e-04
non-small cell lung cancer 1.764 2.0e-24
lung cancer 1.200 2.8e-03
pediatric high grade glioma 1.800 2.1e-06
Endometriosis 1.093 1.1e-02
non-inflammatory breast cancer 1.500 7.1e-04
ovarian cancer 1.900 4.8e-12
psoriasis 1.400 2.6e-68

Gene RIF (16)

PMID Text
24598821 Data indicate Tousled-like kinases (TLK1) phosphorylation has an impact on cell cycle proteins Asf1a and Asf1b function.
24413054 Co-depletion of the histone chaperones ASF1a and ASF1b in human cells induces all hallmarks of alternative lengthening of telomeres in both primary and cancer cells.
23178455 study of the interaction of the histone H3-H4 complex with the RbAp48 and their exchange with a second histone chaperone, anti-silencing function protein 1 (ASF1); exchange of histones H3-H4 between these two histone chaperones has a central role in the assembly of new nucleosomes
23100276 Data indicate that miR-214 down-regulated the expression of PSMD10 (gankyrin) and ASF1B, and gankyrin inhibition induced an increase of P53 mRNA levels.
21179005 Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20227376 Identify marks on histones H3-H4 bound to Asf1 and changes induced upon replication stress.
20133788 Data show that Asf1b localizes with HCF-1 in viral replication foci and depletion of Asf1b results in significantly reduced viral DNA accumulation.
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18378699 ASF1A and ASF1B play a role in the efficiency of nucleosome assembly in vivo in human cells.
18096807 data link Asf1 chaperone function, histone supply, and replicative unwinding of DNA in chromatin; proposed that Asf1, as a histone acceptor and donor, handles parental and new histones at the replication fork via an Asf1-(H3-H4)-MCM2-7 intermediate
17328667 the expression of human ASF1A and ASF1B are upregulated followed by cell proliferation signal, but that of ASF1B is uniquely regulated by transcription factors E2F during cell cycle progression
17054786 Studies provide evidence for TLK1B-mediated phosphorylation of Asf1 triggering DNA repair.
12842904 data suggest that CIA-II is a histone chaperone and is implicated in the regulation of mammalian spermatogenesis
11897662 model is proposed in which the synergism between hAsf1 and CAF-1 for nucleosome formation during DNA repair is achieved through a transient physical interaction allowing histone delivery from Asf1 to CAF-1 [asf1(anti-silencing function 1)]

AA Sequence

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL     71 - 140
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI            141 - 202
//

Text Mined References (38)

PMID Year Title
24616510 2014 Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
24598821 2014 Tousled-like kinases phosphorylate Asf1 to promote histone supply during DNA replication.
24413054 2014 Rapid induction of alternative lengthening of telomeres by depletion of the histone chaperone ASF1.
23178455 2013 Structural plasticity of histones H3-H4 facilitates their allosteric exchange between RbAp48 and ASF1.
23100276 2013 Restoration of microRNA-214 expression reduces growth of myeloma cells through positive regulation of P53 and inhibition of DNA replication.
22407294 2012 Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply.
21269460 2011 Initial characterization of the human central proteome.
21179005 2011 Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.
21113133 2010 RNAi-based screening identifies the Mms22L-Nfkbil2 complex as a novel regulator of DNA replication in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20227376 2010 Replication stress interferes with histone recycling and predeposition marking of new histones.
20133788 2010 Transcriptional coactivator HCF-1 couples the histone chaperone Asf1b to HSV-1 DNA replication components.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20016786 2009 Phosphorylation-mediated control of histone chaperone ASF1 levels by Tousled-like kinases.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19410544 2009 Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.
18378699 2008 In vivo study of the nucleosome assembly functions of ASF1 histone chaperones in human cells.
18096807 2007 Regulation of replication fork progression through histone supply and demand.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17328667 2007 Transcriptional regulation of human chromatin assembly factor ASF1.
17054786 2006 TLK1B promotes repair of UV-damaged DNA through chromatin remodeling by Asf1.
16980972 2006 Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16537536 2006 Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells.
16151251 2005 Functional conservation and specialization among eukaryotic anti-silencing function 1 histone chaperones.
15664198 2005 Human Asf1 regulates the flow of S phase histones during replicational stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15020040 2004 Histone chaperones, a supporting role in the limelight.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842904 2003 Transcription initiation factor IID-interactive histone chaperone CIA-II implicated in mammalian spermatogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11897662 2002 Human Asf1 and CAF-1 interact and synergize in a repair-coupled nucleosome assembly pathway.
11470414 2001 Identification of human Asf1 chromatin assembly factors as substrates of Tousled-like kinases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.