Property Summary

NCBI Gene PubMed Count 5
PubMed Score 21.75
PubTator Score 16.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 2.1e-03
medulloblastoma, large-cell 1.400 7.9e-06
osteosarcoma 1.400 5.0e-06
ovarian cancer 1.200 6.4e-08
psoriasis 1.300 7.2e-04

AA Sequence

MDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEP      1 - 70
CPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKY     71 - 140
INYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV                                  141 - 180
//

Text Mined References (5)

PMID Year Title