Property Summary

NCBI Gene PubMed Count 75
PubMed Score 258.01
PubTator Score 198.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 3.500 8.0e-03
oligodendroglioma 2.700 2.7e-17
psoriasis 1.200 5.1e-04
glioblastoma 1.600 2.7e-02
osteosarcoma 1.092 5.3e-03
posterior fossa group B ependymoma 2.100 3.1e-04
medulloblastoma -3.700 2.9e-04
medulloblastoma, large-cell -4.200 6.8e-07
primitive neuroectodermal tumor 1.800 5.6e-04
lung cancer 4.200 3.6e-07
pediatric high grade glioma 1.800 2.7e-03
atypical teratoid/rhabdoid tumor 1.400 1.5e-02
pilocytic astrocytoma 3.000 4.3e-09
subependymal giant cell astrocytoma -2.926 2.1e-02
lung carcinoma 3.700 8.8e-16
ovarian cancer -1.700 9.7e-07
pituitary cancer -3.600 1.1e-03
head and neck cancer and chronic obstruc... -1.400 4.8e-02
non-small cell lung cancer and chronic o... -1.400 3.4e-02

Gene RIF (56)

PMID Text
27076429 This report identifies novel roles for the transcription factor Ascl1 in enteric gliogenesis and neurogenesis
26596584 hASH1 is a specific marker to distinguish neuroendocrine tumors from squamous cell carcinomas and adenocarcinomas
26403073 Data show that chrysin suppressed cell proliferation and reducing expression of achaete-scute complex-like 1 (ASCL1) and the neuroendocrine biomarker chromogranin A (CgA).
26292211 marker for neurogenic potential in cultured retinal progenitor cells
26253517 ASCL1 expression is regulated by BRD4 is frequently overexpressed in small cell lung cancer.
25267614 Achaete-scute homolog 1 (ASCL1), a transcription factor required for proper development of pulmonary neuroendocrine cells, is essential for the survival of a majority of lung cancers with neuroendocrine features.
25124043 data suggest that a prominent down-regulation of hnRNP-A2/B1 during hypoxia is associated with the post-transcriptional suppression of hASH1 synthesis.
24982138 lentiviral overexpression of transcription factors ASCL1, SOX10, and NKX2.2 in NPCs was sufficient to induce Sox10 enhancer activity, OPC mRNA, and protein expression consistent with OPC fate
24037524 ASCL1 and RET expression defines a clinically relevant subgroup of lung adenocarcinoma characterized by neuroendocrine differentiation.
23739972 Ascl1 modulates multiple steps of oligodendrocyte precursor cell development in the postnatal brain and in response to demyelinating insults.
23739064 Gene expression profiling revealed that permissive lines are typified by lower expression of the early neurogenic transcription factor ASCL1 and, conversely, by higher expression of the late neurogenic transcription factor NEUROD1.
23707066 ASCL1 Promotes Wnt Signaling Directly by Repressing DKK1.
23657976 ASH1 overexpression in prostate cancer cells promotes neuroendocrine differentiation and increased cell viability.
23530560 BRN2 is a higher level regulator than ASCL1 and ND1 and BRN2 might be involved in aggressiveness of small cell lung cancer.
23375646 Achaete-scute homolog 1 may be proposed as a diagnostic marker of poor differentiation and may help to differentiate neuroendocrine carcinomas from neuroendocrine tumors in difficult cases.
23300791 Ascl1 directly regulates expression of matrix metalloproteinase-7 and O(6)-methylguanine-DNA methyltransferase.
22422124 hASH-1 expression occurs in breast cancers with neuroendocrine differentiation regardless of the extent of the NE cell population, and it is restricted to a subset of tumor cells having a low proliferative potential.
22172490 Dual-luciferase assays showed that ASCL1 activated the expression of miR-375 by binding to the three E-box elements in the miR-375 promoter. These results imply a role of ASCL1 in SCLC via the upregulation of miR-375.
21856745 miR-375 is a key downstream effector of ASH1 function in lung cancer cells
21737174 The ASCL1 knock-down gene set also classified the 171 adenocarcinomas into three subtypes and this NE subtype also had the poorest prognosis.
21684625 Among human primary tumors, 2/2 SCLC, 5/5 pulmonary carcinoids, and 10/41 non-SCLC (only 4 of which had NE features) were positive for hASH1 by immunohistochemistry and RNA-RNA in situ hybridization.
21573214 The present results suggest that a transcriptional complex of LMO3 and HEN2 may contribute to the genesis and malignant phenotype of neuroblastoma by inhibiting HES1 which suppresses the transactivation of Mash1.
21495212 HASH1 down-regulation is associated with cell proliferation, thereby resulting in uterine carcinogenesis.
20842449 ASCL1-pathway is responsible for the up-regulation of IGF2 during neuroblastoma differentiation.
20677557 hASH1 is a new kind of highly specific markers of pulmonary neuroendocrine tumours, and may be applied to clinical pathology diagnosis of the pulmonary neuroendocrine tumors.
20659153 deletional rearrangement of the TCR delta gene disrupted the hypothetical gene C12orf42 and brought the Achaete-scute complex homolog 1 gene into proximity of the TRA enhancer, which is overexpressed in thyroid and lung cancers
20538960 Observational study of gene-disease association. (HuGE Navigator)
20515335 Supratentorial PNETs expressed significantly higher levels of SOX2, NOTCH1, ID1, and ASCL-1 transcripts.
20206680 report the analysis of 9 highly conserved putative enhancers in a 64kb interval encompassing the human ASCL1 locus
20124469 Our data indicate a specific role for ASCL1 in regulating the expression of the CHRNA5/A3/B4 lung cancer susceptibility locus. This regulation may contribute to the predicted role that ASCL1 plays in SCLC tumorigenesis.
20097173 these support the role of the polyglutamine length variants in the MASH1 gene in Parkinson's disease susceptibility.
20097173 Observational study of gene-disease association. (HuGE Navigator)
19744316 Expression of DKK1 and TPH1 were negatively regulated by ASCL1 in pancreatic endocrine tumours.
19176379 Findings suggest that a broad range of SCLC cells has tumorigenic capacity rather than a small discrete population. Intrinsic tumor cell heterogeneity, including variation in key regulatory factors such as ASCL1, can modulate tumorigenicity in SCLC.
19097999 Improved translation efficiency of ASH1 mRNA by FMRP may represent an important regulatory switch in neuronal differentiation.
19008346 By overexpressing ASCL1, neurogenesis from human neural progenitor cells was regained, which produced larger neurons with more neurites than hNPC but no fully mature dopamine neurons.
18802035 Mash1 has a role in regulation of prenatal human retinal neurosphere growth and cell fate potential by retinal pigment epithelium
18587322 MASH1 is a useful adjunct marker for differentiating small cell carcinoma of the lung from Merkel cell carcinoma.
18587321 Tumor marker mASH1 was highly (sensitivity of 71%) and specifically (specificity of 95%) expressed in poorly differentiated neuroendocrine carcinoma.
18585058 The Ascl1 cell lineage generates Purkinje cells, deep cerebellar nuclei interneurons and oligodendrocytes at specific stages in the transgenic mouse cerebellum.
18491256 lack of nuclear expression of HES1 may contribute to the abundance of ASCL1 and to tumorigenesis in the endocrine pancreas.
18339843 ASH1 functions as a dual transcription factor by activating neuroendocrine differentiation markers and also repressing putative tumor suppressors.
18311112 In prostate cancers with neuroendocrine differentiation...hASH1 transcript levels in androgen deprivation-treated compared with untreated patients
17507989 Knockdown of ASH1 gene in lung neoplasm cells in vitro suppressed growth by increasing apoptosis.
16899352 Observational study of gene-disease association. (HuGE Navigator)
16103883 Upregulation of ASCL1 and inhibition of Notch signaling pathway characterize progressive astrocytoma
16029117 RaF-1 activation causes cessation of hASH-1 expression
16021468 Observational study of gene-disease association. (HuGE Navigator)
16021468 The present genetic data may thus suggest that polyglutamine length polymorphisms in ASCL1 could influence predispositions to PD through the fine-tuning of LC integrity.
15701827 Up-Regulation of ASCL1 is associated with gastrointestinal neuroendocrine carcinomas
15272537 the hASH1 mRNA level might represent a useful tool for distinguishing esthesioneuroblastoma from poorly differentiated tumors of the sinonasal region
15240857 Observational study of gene-disease association. (HuGE Navigator)
14759067 ASH1 is a neuroendocrine marker whose expression is largely conserved in normal and neoplastic pituitary cells.
14668716 HASH1 appears to be important in the endocrine phenotype of medullary thyroid carcinoma (MTC) tumors and may serve as a molecular target for the treatment of patients with MTC.
14532329 We also studied the proneural HASH-1 gene and identified a heterozygous nucleotide substitution in three CCHS patients
11948117 HASH1 mRNA expression levels in SCLC clinical samples were 1,000-fold higher than in the NSCLC samples, and this method could contribute to diagnosis based on molecular profiling of tumors.

AA Sequence

MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA      1 - 70
DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT     71 - 140
LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS    141 - 210
SYSSDEGSYDPLSPEEQELLDFTNWF                                                211 - 236
//

Text Mined References (76)

PMID Year Title
27076429 2016 Ascl1 Is Required for the Development of Specific Neuronal Subtypes in the Enteric Nervous System.
26596584 2016 hASH1 is a specific immunohistochemical marker for lung neuroendocrine tumors.
26403073 2015 Chrysin suppresses achaete-scute complex-like 1 and alters the neuroendocrine phenotype of carcinoids.
26292211 2015 VSX2 and ASCL1 Are Indicators of Neurogenic Competence in Human Retinal Progenitor Cultures.
26253517 2015 Sensitivity of Small Cell Lung Cancer to BET Inhibition Is Mediated by Regulation of ASCL1 Gene Expression.
25267614 2014 ASCL1 is a lineage oncogene providing therapeutic targets for high-grade neuroendocrine lung cancers.
25124043 2014 Shutdown of achaete-scute homolog-1 expression by heterogeneous nuclear ribonucleoprotein (hnRNP)-A2/B1 in hypoxia.
24982138 2014 Transcription factor induction of human oligodendrocyte progenitor fate and differentiation.
24037524 2014 ASCL1 and RET expression defines a clinically relevant subgroup of lung adenocarcinoma characterized by neuroendocrine differentiation.
23739972 2013 Ascl1/Mash1 promotes brain oligodendrogenesis during myelination and remyelination.
23739064 2013 Selective tropism of Seneca Valley virus for variant subtype small cell lung cancer.
23707066 2013 An aberrant transcription factor network essential for Wnt signaling and stem cell maintenance in glioblastoma.
23657976 2013 Human ASH-1 promotes neuroendocrine differentiation in androgen deprivation conditions and interferes with androgen responsiveness in prostate cancer cells.
23530560 2013 POU domain transcription factor BRN2 is crucial for expression of ASCL1, ND1 and neuroendocrine marker molecules and cell growth in small cell lung cancer.
23375646 2013 Achaete-scute homolog 1 as a marker of poorly differentiated neuroendocrine carcinomas of different sites: a validation study using immunohistochemistry and quantitative real-time polymerase chain reaction on 335 cases.
23300791 2012 Achaete-scute complex homolog-1 promotes DNA repair in the lung carcinogenesis through matrix metalloproteinase-7 and O(6)-methylguanine-DNA methyltransferase.
22422124 2012 Human achaete-scute homolog-1 expression in neuroendocrine breast carcinoma.
22172490 2012 miR-375 is highly expressed and possibly transactivated by achaete-scute complex homolog 1 in small-cell lung cancer cells.
21856745 2011 miR-375 is activated by ASH1 and inhibits YAP1 in a lineage-dependent manner in lung cancer.
21737174 2012 ASCL1-coexpression profiling but not single gene expression profiling defines lung adenocarcinomas of neuroendocrine nature with poor prognosis.
21684625 2012 Insights into the achaete-scute homolog-1 gene (hASH1) in normal and neoplastic human lung.
21573214 2011 Oncogenic LMO3 collaborates with HEN2 to enhance neuroblastoma cell growth through transactivation of Mash1.
21495212 2010 Hes1/Hes5 gene inhibits differentiation via down-regulating Hash1 and promotes proliferation in cervical carcinoma cells.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
20842449 2011 Down-regulation of achaete-scute complex homolog 1 (ASCL1) in neuroblastoma cells induces up-regulation of insulin-like growth factor 2 (IGF2).
20677557 2010 [Expression and clinicopathologic significance of human achaete-scute homolog 1 in pulmonary neuroendocrine tumors].
20659153 2010 Molecular characterization of a novel chromosomal translocation t(12;14)(q23;q11.2) in T-lymphoblastic lymphoma between the T-cell receptor delta-deleting elements (TRDREC and TRAJ61) and the hypothetical gene C12orf42.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20515335 2010 Upregulation of SOX2, NOTCH1, and ID1 in supratentorial primitive neuroectodermal tumors: a distinct differentiation pattern from that of medulloblastomas.
20206680 2010 Efficient discovery of ASCL1 regulatory sequences through transgene pooling.
20124469 2010 ASCL1 regulates the expression of the CHRNA5/A3/B4 lung cancer susceptibility locus.
20097173 2010 Examination of the MASH1 gene in patients with Parkinson's disease.
19744316 2009 Identification of Achaete-scute complex-like 1 (ASCL1) target genes and evaluation of DKK1 and TPH1 expression in pancreatic endocrine tumours.
19176379 2009 Achaete-scute complex homologue 1 regulates tumor-initiating capacity in human small cell lung cancer.
19097999 2009 Translational regulation of the human achaete-scute homologue-1 by fragile X mental retardation protein.
19008346 2009 Regionally specified human neural progenitor cells derived from the mesencephalon and forebrain undergo increased neurogenesis following overexpression of ASCL1.
18802035 2008 Regulation of prenatal human retinal neurosphere growth and cell fate potential by retinal pigment epithelium and Mash1.
18587322 2008 MASH1: a useful marker in differentiating pulmonary small cell carcinoma from Merkel cell carcinoma.
18587321 2008 The expression of NeuroD and mASH1 in the gastroenteropancreatic neuroendocrine tumors.
18585058 2008 Ascl1 (Mash1) lineage cells contribute to discrete cell populations in CNS architecture.
18491256 2008 Lack of nuclear expression of hairy and enhancer of split-1 (HES1) in pancreatic endocrine tumors.
18339843 2008 Roles of achaete-scute homologue 1 in DKK1 and E-cadherin repression and neuroendocrine differentiation in lung cancer.
18311112 2008 Human ASH1 expression in prostate cancer with neuroendocrine differentiation.
17923682 2007 Mammalian ASH1L is a histone methyltransferase that occupies the transcribed region of active genes.
17507989 2007 Achaete-scute homolog-1 linked to remodeling and preneoplasia of pulmonary epithelium.
16899352 2006 Analysis of coding-polymorphisms in NOTCH-related genes reveals NUMBL poly-glutamine repeat to be associated with schizophrenia in Brazilian and Danish subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16160079 2005 Conservation of the Notch1 signaling pathway in gastrointestinal carcinoid cells.
16103883 2005 Upregulation of ASCL1 and inhibition of Notch signaling pathway characterize progressive astrocytoma.
16029117 2005 Medullary thyroid cancer: the functions of raf-1 and human achaete-scute homologue-1.
16021468 2005 Genetic association analyses of PHOX2B and ASCL1 in neuropsychiatric disorders: evidence for association of ASCL1 with Parkinson's disease.
15701827 2005 Aberrant expression of human achaete-scute homologue gene 1 in the gastrointestinal neuroendocrine carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15272537 2004 Human achaete-scute homologue (hASH1) mRNA level as a diagnostic marker to distinguish esthesioneuroblastoma from poorly differentiated tumors arising in the sinonasal tract.
15240857 2004 Sudden infant death syndrome: case-control frequency differences at genes pertinent to early autonomic nervous system embryologic development.
14759067 2003 Human pituitary tumours express the bHLH transcription factors NeuroD1 and ASH1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668716 2003 The role of human achaete-scute homolog-1 in medullary thyroid cancer cells.
14532329 2003 Noradrenergic neuronal development is impaired by mutation of the proneural HASH-1 gene in congenital central hypoventilation syndrome (Ondine's curse).
12858003 2003 Mechanisms of neuroendocrine differentiation in pulmonary neuroendocrine cells and small cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050665 2002 Origin of GABAergic neurons in the human neocortex.
12000752 2002 Activation of the phosphatidylinositol 3-kinase/Akt signaling pathway by retinoic acid is required for neural differentiation of SH-SY5Y human neuroblastoma cells.
11940670 2002 Notch signaling induces rapid degradation of achaete-scute homolog 1.
11825874 2002 Divergent functions of the proneural genes Mash1 and Ngn2 in the specification of neuronal subtype identity.
11736660 2001 Proprotein convertase PACE4 is down-regulated by the basic helix-loop-helix transcription factor hASH-1 and MASH-1.
11309412 2001 An exclusively nuclear RNA-binding protein affects asymmetric localization of ASH1 mRNA and Ash1p in yeast.
11171979 2001 Ash1p is a site-specific DNA-binding protein that actively represses transcription.
10903890 2000 HASH-1 and E2-2 are expressed in human neuroblastoma cells and form a functional complex.
10656681 2000 Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins.
9197246 1997 MASH1 maintains competence for BMP2-induced neuronal differentiation in post-migratory neural crest cells.
9186001 1997 Tissue-specific expression of human achaete-scute homologue-1 in neuroendocrine tumors: transcriptional regulation by dual inhibitory regions.
9126746 1997 An achaete-scute homologue essential for neuroendocrine differentiation in the lung.
8662987 1996 Functional and physical interactions between mammalian achaete-scute homolog 1 and myocyte enhancer factor 2A.
8595908 1995 Localization of the human achaete-scute homolog gene (ASCL1) distal to phenylalanine hydroxylase (PAH) and proximal to tumor rejection antigen (TRA1) on chromosome 12q22-q23.
8390674 1993 Identification of a human achaete-scute homolog highly expressed in neuroendocrine tumors.