Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.48
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (7)

Gene RIF (1)

AA Sequence

MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCACMVSDADCVE      1 - 70
LLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDTPLHWAAFKNNAECVRALLES     71 - 140
GASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVINLIGQTPISRLVALLVRGLGTEKEDSCFEL    141 - 210
LHRAVGHFELRKNGTMPREVARDPQLCEKLTVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPASL    211 - 280
KEYLLLLE                                                                  281 - 288
//

Text Mined References (10)

PMID Year Title