Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.06
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.100 3.4e-02
Astrocytoma, Pilocytic 2.000 1.2e-03
psoriasis -1.800 9.6e-12

Gene RIF (1)

AA Sequence

MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYGVTQGQGSWAD      1 - 70
RSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACARTLLEAGANVNAITIDGVTPL     71 - 140
FNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGHHECLDILISWGIDVDQEIPHLGTPLYVACM    141 - 210
SQQFHCIWKLLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVE    211 - 280
RILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR                         281 - 329
//

Text Mined References (7)

PMID Year Title