Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.87
PubTator Score 3.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 5.4e-47
psoriasis 6685 9.4e-15
ovarian cancer 8491 1.3e-07
medulloblastoma, large-cell 6234 2.2e-03
pituitary cancer 1972 3.8e-03

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.100 2.2e-03
lung carcinoma 5.000 5.4e-47
ovarian cancer 1.100 1.3e-07
pituitary cancer -2.100 3.8e-03
psoriasis -1.200 9.4e-15

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
15929745 Based on its differential expression, neuroanatomical distribution and colocalisation, we hypothesise that rat Asb-4 is a gene involved in energy homeostasis.

AA Sequence

MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASYKQGYWLPSYK      1 - 70
LKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSG     71 - 140
HTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMET    141 - 210
PLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANL    211 - 280
MDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRW    281 - 350
NTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLE    351 - 420
PEGIIY                                                                    421 - 426
//

Text Mined References (10)

PMID Year Title
17636018 2007 ASB4 is a hydroxylation substrate of FIH and promotes vascular differentiation via an oxygen-dependent mechanism.
15929745 2005 Arcuate nucleus transcriptome profiling identifies ankyrin repeat and suppressor of cytokine signalling box-containing protein 4 as a gene regulated by fasting in central nervous system feeding circuits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11111040 2000 Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, Asb-3 and Asb-4.
11076863 2000 DNA cloning using in vitro site-specific recombination.