Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.01
PubTator Score 26.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer 1.300 4.8e-04
Barrett's esophagus 1.100 2.5e-02
esophageal adenocarcinoma 1.200 1.8e-02
psoriasis -1.100 3.8e-07
osteosarcoma -1.021 3.8e-02
Duchenne muscular dystrophy 1.060 4.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.157 6.7e-03
juvenile dermatomyositis 1.195 6.1e-11
tuberculosis 1.900 4.5e-06
intraductal papillary-mucinous adenoma (... 2.000 8.4e-04
intraductal papillary-mucinous carcinoma... 1.900 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.4e-02
lung cancer -1.500 1.1e-04
fibroadenoma -1.200 1.9e-02
pancreatic carcinoma 1.300 4.8e-04
spina bifida -1.661 2.6e-02
ovarian cancer 1.200 1.8e-02
pituitary cancer -1.400 7.2e-04

Gene RIF (2)

PMID Text
20944657 Observational study of gene-disease association. (HuGE Navigator)
15231847 regulates multiple cytokine and growth factor-activated signaling pathways by acting as a recruitment factor for adapter proteins

AA Sequence

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVE      1 - 70
NEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKG     71 - 140
DLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKI    141 - 210
KKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVE    211 - 280
QKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLN    281 - 350
LLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT    351 - 420
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAK    421 - 490
NIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIF    491 - 560
GLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCL    561 - 630
TDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDE    631 - 700
SDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGS    701 - 770
PPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN    771 - 840
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRG    841 - 910
PVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQE    911 - 980
WWIGHIDGDPGRKGAFPVSFVHFIAD                                                981 - 1006
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23999061 2014 The ASAP2 gene is a primary target of 1,25-dihydroxyvitamin D3 in human monocytes and macrophages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20936779 2010 A human MAP kinase interactome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18786926 2008 Identification of a link between the SAMP repeats of adenomatous polyposis coli tumor suppressor and the Src homology 3 domain of DDEF.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255943 2007 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15719014 2005 Expression of AMAP1, an ArfGAP, provides novel targets to inhibit breast cancer invasive activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483625 2004 Regulation of Bin1 SH3 domain binding by phosphoinositides.
15231847 2004 A novel mode of action of an ArfGAP, AMAP2/PAG3/Papa lpha, in Arf6 function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149250 2002 Interaction of POB1, a downstream molecule of small G protein Ral, with PAG2, a paxillin-binding protein, is involved in cell migration.
11716503 2001 Interaction of poly(A) polymerase with the 25-kDa subunit of cleavage factor I.
11304556 2001 PAG3/Papalpha/KIAA0400, a GTPase-activating protein for ADP-ribosylation factor (ARF), regulates ARF6 in Fcgamma receptor-mediated phagocytosis of macrophages.
10749932 2000 A new paxillin-binding protein, PAG3/Papalpha/KIAA0400, bearing an ADP-ribosylation factor GTPase-activating protein activity, is involved in paxillin recruitment to focal adhesions and cell migration.
10022920 1999 Identification of a new Pyk2 target protein with Arf-GAP activity.
9819391 1998 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.