Property Summary

NCBI Gene PubMed Count 40
PubMed Score 60.73
PubTator Score 50.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.100 2.3e-03
astrocytoma 1.400 3.3e-02
Duchenne muscular dystrophy 1.323 1.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.265 1.7e-03
juvenile dermatomyositis 1.830 3.3e-12
acute quadriplegic myopathy 1.375 5.8e-05
primary pancreatic ductal adenocarcinoma 1.674 8.7e-04
sarcoidosis 1.100 3.2e-02
primary Sjogren syndrome 1.300 1.1e-04
subependymal giant cell astrocytoma 1.325 2.5e-02
gastric carcinoma 1.300 2.1e-02
ulcerative colitis 2.200 4.1e-07
ovarian cancer 1.400 2.7e-03
Breast cancer 1.400 3.3e-04
pancreatic cancer 1.800 8.1e-04

Protein-protein Interaction (6)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624377 screening 680 / 0 / 362197 Fluorescence polarization-based biochemical primary high throughput screening assay to identify inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
624386 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
624431 screening 230 / 0 / 392 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
651680 confirmatory 8 / 0 / 81 Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)

Gene RIF (21)

PMID Text
26893376 results support the hypothesis that ASAP1 is a positive regulator of NM2A.
25774636 High ASAP1 expression, that was reduced after Mycobacterium tuberculosis infection, and rs10956514, are associated with the level of reduction of ASAP1 expression.
25673879 Rab11-FIP3 coordinates the interactions of ASAP1 and Rab11a with Rabin8.
24865276 The activation of NF-kappaB induced translocation of AMAP1 to cytoplasm from cell membrane and nucleus, which resulted in augmented interaction of AMAP1 and IKKbeta
24788532 ASAP1 appears to contribute to the malignant mechanism of LSCC and may represent a significant prognostic marker for laryngeal squamous cell carcinoma patients.
24427349 results indicated that elevated expression of ASAP1 plays an important role in the progression and metastasis of ovarian cancer
24116160 Data show that co-overexpression of GEP100 and AMAP1 (ASAP1) correlates with rapidity of the local recurrence.
22734003 found that AMAP1 had the ability to bind directly to PRKD2 and hence to make a complex with the cytoplasmic tail of the beta1 subunit
21858086 Data suggest that GEP100-Arf6-AMAP1-cortactin pathway, activated by VEGFR2, appears to be common in angiogenesis and cancer invasion and metastasis, and provides their new therapeutic targets.
21352810 GEFH1 was identified as binding partner for the BAR domain of ASAP1.GEFH1 is a negative regulator of podosomes.
20154719 ASAP1 can contribute to the dissemination of a variety of tumor types and represent a potential target for cancer therapy.
19017632 Autoinhibition of Arf GTPase-activating protein activity by the BAR domain in ASAP1
18685082 ASAP1, like FIP3, functions as a component of the endocytic recycling compartment
18519696 study suggests that the ASAP1 gene plays a role in prostate cancer metastasis and may represent a therapeutic target and/or biomarker for metastatic disease
18400762 ASAP3 functions nonredundantly with ASAP1 to control cell movement and may have a role in cancer cell invasion.
16636290 Results suggest that the AMAP1/cortactin complex, which is not detected in normal mammary epithelial cells, is an excellent drug target for cancer therapeutics.
16038802 Results support a model that regulation of GAP (GTPase-activating protein) activity of ASAP1 involves conformational changes, coincident with recruitment to a membrane surface and following the specific binding of phosphatidylinositol 4,5-bisphosphate.
15897555 DDEF1 overexpression may be a pathogenetically relevant consequence of chromosome 8q amplification, which commonly occurs in high-grade uveal melanomas
12522101 involved in peripheral focal adhesions, directed by CRKL protein
12149250 These results suggest that POB1 interacts with PAG2 through its proline-rich motif, thereby regulating cell migration (PAG2).
11773070 DEF-1 alters cell motility through the deactivation of ARF1. In contrast, the inhibition of cell spreading by DEF-1 was not dependent on GAP activity, indicating that spreading and motility are altered by DEF-1 through different pathways.

AA Sequence

MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTA      1 - 70
LQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLS     71 - 140
HNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKE    141 - 210
RRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQD    211 - 280
EEKKQLTALRDLIKSSLQLDQKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVK    281 - 350
NGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT    351 - 420
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISR    421 - 490
IQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCSTS    491 - 560
SAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNL    561 - 630
DKQTALGNTVLHYCSMYSKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPH    631 - 700
VHVEYEWNLRQEEIDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAF    701 - 770
TNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD    771 - 840
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKTDHLS    841 - 910
LDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPGELPPKPQLGDLPPKPQLSDL    911 - 980
PPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPT    981 - 1050
LPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFP   1051 - 1120
VSFVHILSD                                                                1121 - 1129
//

Text Mined References (49)

PMID Year Title
26893376 2016 The Arf GTPase-activating Protein, ASAP1, Binds Nonmuscle Myosin 2A to Control Remodeling of the Actomyosin Network.
25774636 2015 Susceptibility to tuberculosis is associated with variants in the ASAP1 gene encoding a regulator of dendritic cell migration.
25673879 2015 The Arf and Rab11 effector FIP3 acts synergistically with ASAP1 to direct Rabin8 in ciliary receptor targeting.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24865276 2014 AMAP1 as a negative-feedback regulator of nuclear factor-?B under inflammatory conditions.
24788532 2014 ASAP1 mediates the invasive phenotype of human laryngeal squamous cell carcinoma to affect survival prognosis.
24427349 2014 Overexpression of ASAP1 is associated with poor prognosis in epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116160 2013 Co-overexpression of GEP100 and AMAP1 proteins correlates with rapid local recurrence after breast conservative therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22734003 2012 Rab5c promotes AMAP1-PRKD2 complex formation to enhance ?1 integrin recycling in EGF-induced cancer invasion.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21858086 2011 GEP100-Arf6-AMAP1-cortactin pathway frequently used in cancer invasion is activated by VEGFR2 to promote angiogenesis.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21352810 2011 GEFH1 binds ASAP1 and regulates podosome formation.
20936779 2010 A human MAP kinase interactome.
20509626 2010 Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
20393563 2010 Functional genomic screen for modulators of ciliogenesis and cilium length.
20154719 2010 ASAP1 promotes tumor cell motility and invasiveness, stimulates metastasis formation in vivo, and correlates with poor survival in colorectal cancer patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19017632 2009 Autoinhibition of Arf GTPase-activating protein activity by the BAR domain in ASAP1.
18786926 2008 Identification of a link between the SAMP repeats of adenomatous polyposis coli tumor suppressor and the Src homology 3 domain of DDEF.
18685082 2008 Arf GTPase-activating protein ASAP1 interacts with Rab11 effector FIP3 and regulates pericentrosomal localization of transferrin receptor-positive recycling endosome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519696 2008 ASAP1, a gene at 8q24, is associated with prostate cancer metastasis.
18400762 2008 ASAP3 is a focal adhesion-associated Arf GAP that functions in cell migration and invasion.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17255943 2007 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
16636290 2006 Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16038802 2005 Regulation of ASAP1 by phospholipids is dependent on the interface between the PH and Arf GAP domains.
15897555 2005 DDEF1 is located in an amplified region of chromosome 8q and is overexpressed in uveal melanoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15090612 2004 CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12522101 2003 CrkL directs ASAP1 to peripheral focal adhesions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149250 2002 Interaction of POB1, a downstream molecule of small G protein Ral, with PAG2, a paxillin-binding protein, is involved in cell migration.
12058076 2002 The association of ASAP1, an ADP ribosylation factor-GTPase activating protein, with focal adhesion kinase contributes to the process of focal adhesion assembly.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11773070 2002 DEF-1/ASAP1 is a GTPase-activating protein (GAP) for ARF1 that enhances cell motility through a GAP-dependent mechanism.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9819391 1998 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src.