Property Summary

NCBI Gene PubMed Count 72
PubMed Score 124.10
PubTator Score 124.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 5.5e-14

Gene RIF (71)

PMID Text
26411936 Its genotype-dependent differences in arsenic metabolism is noted.(review)
26366667 a strong signal of positive selection in the main arsenic methyltransferase AS3MT gene, which has been previously associated with lower concentrations of the most toxic product of arsenic metabolism monomethylarsonic acid.
26209557 genome-wide association study in population in United States (AZ, OK, SD, ND): Data suggest SNPs in AS3MT (rs17878846, rs10509760) partly explain inter-individual variability in susceptibility to arsenic poisoning (and urine arsenic species patterns).
25491248 The present study found that rs3740400 in As3MT and rs156697 in GSTO2 were strongly associated with the arsenic species (%iAs, %MMA and MMA/iAs and DMA/MMA ratios) in urine of the occupationally exposed workers and they may influence methylation capacity.
25461954 This study's results provide preliminary evidence for the over-transmission of the A allele at the AS3MT rs11191454 polymorphism in Attention Deficit Hyperactivity Disorder.
25447140 Functions of arsenic (III) methyltransferase S-adenosylmethionine binding site were evaluated.
25349987 analysis of the functional roles of GSH and the crucial Cys residues in iAs3+ methylation catalyzed by hAS3MT
25156000 Genetic variation in AS3MT gene is associated with arsenic metabolism and risk of basal cell carcinoma.
24845704 Influence of the level of arsenic exposure and the presence of T860C polymorphism in human As urinary metabolic profile
24792412 polymorphisms may impact disease susceptibility [review]
24621105 Low-level arsenic exposure is associated with cognitive functioning; however, this association is modified by an AS3MT gene.
24536095 AS3MT SNPs were associated with arsenic metabolism efficiency and arsenic toxicity in exposed individuals.
24361376 when workers were classified according to their AS3MT Met287Thr genotypes, significantly higher micronucleus values were for those carrying the variant allele [odds ratio (OR), 3.4 (1.6-5.2); P=0.0003)]
24239724 Genetic polymorphisms in AS3MT gene in a Western Chinese population influenced urinary arsenic metabolism from arsenic in drinking water.
24154821 A hypomethylated region in the AS3MT promoter was associated with higher arsenic exposure.Arsenic exposure influences the epigenetic regulation of AS3MT.
23742935 Residues Asp76, 84, 102 and 150 greatly influence hAS3MT catalytic activity, affecting S-adenosylmethionine-binding or methyl transfer.
23665909 Five N6AMT1 single nucleotide polymorphisms and two N6AMT1 haplotypes were significantly associated with the percentage of methylarsonic acid in urine, even after adjusting for arsenic (+3 oxidation state) methyltransferase haplotype.
23341986 the AS3MT haplotype status strongly predicted DNA methylation and gene expression of AS3MT as well as several genes in 10q2
23093101 Individuals with M287T and G4965C AS3MT polymorphisms had higher levels of urinary DMAs(III) and were more frequently diabetic than the respective wild-type carriers, although the excess was not statistically significant
23070617 Data raise the possibility that, during a few thousand years, natural selection for tolerance to the environmental stressor arsenic may have increased the frequency of protective variants of AS3MT.
22955273 analysis of rapid equilibrium kinetics of arsenite methylation catalyzed by recombinant human arsenic (+3 oxidation state) methyltransferase (hAS3MT)
22747749 Single nucleotide polymorphisms (SNPs) in arsenic methyltransferase and methylene-tetrahydrofolate reductase is associated with bladder cancer in those exposed to low concentrations of inorganic arsenic. SNPs in glutathione S-transferase omega-1 are not.
22712827 structural insights into the mechanism of substrate binding and catalysis
22547080 Pregnancy and the AS3MT genotype independently influence the arsenic methylation phenotype
22341486 Coronary heart disease and its main risk factors were associated with low-level arsenic exposure, AS3MT polymorphism or both. Hypertension was associated with higher arsenic exposure, while hyperlipidemia was associated AS3MT polymorphism.
22339537 Genetic polymorphisms GSTO and As3MT modify arsenic metabolism as evidenced by altered urinary arsenic excretion
22005461 These data suggest that the expression pattern of splicing variants of the As3MT gene may affect the capacity for arsenic methylation in cells.
21731446 Two SNPs, AS3MT 12390 (rs3740393) and 14458 (rs11191439) were consistently related to arsenic methylation regardless of the populations examined for the analysis.
21537954 investigation of the roles of AS3MT in the effects of arsenicals, carcinogens found ubiquitously in nature: metabolism, toxicity, and accumulation of arsenicals in hepatocytes
21247820 Polymorphisms in AS3MT significantly predicted As metabolism across these two very different populations, suggesting that AS3MT may have an impact on As metabolite patterns in populations worldwide.
20971157 enzymatic activity, kinetics, thermal stability and secondary structures of mutant enzyme
20877624 Observational study of gene-disease association. (HuGE Navigator)
20621156 an ordered sequence for the binding of SAM and arsenite to the hAS3MT; whereas, no interactions between GSH and the hAS3MT were detected.
20571777 Distribution of 18 SNPs in AS3MT was assessed in healthy individuals in Mexico and Germany: 38 Mestizo, 69 Nahuas, 50 Huicholes, and 32 Germans.
20571777 Observational study of genotype prevalence. (HuGE Navigator)
20547570 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20532380 As3MT effects organic arsenic metabolism
20532380 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20129672 Data suggest that the inhibitory effect of the ions (Co(2+), Mn(2+), and Zn(2+)) or selenite on AS3MT activity might be via the interactions of them with free Cys residues in human AS3MT to form inactive protein adducts.
20014157 Investigation of 46 SNPs [Mexico]: Genetic association analysis with arsenic metabolism confirmed the previously observed association between AS3MT variants, including this large cluster of linked polymorphisms, and arsenic methylation efficiency
20014157 Observational study of gene-disease association. (HuGE Navigator)
19932709 The present study is the first to demonstrate the existence of genetic heterogeneity in a world wide distribution of 18 single nucleotide polymorphisms in AS3MT
19932709 Observational study of genotype prevalence. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19538983 Observational study of gene-disease association. (HuGE Navigator)
19411561 These data link the AS3MT-catalyzed methylation of iAs to specific genomic responses in human cells exposed to iAs(III).
19371612 The relationship between single nucleotide polymorphisms of AS3MT and hair and urine levels of arsenic in male and female Vietnamese are reported.
19371612 Observational study of gene-disease association. (HuGE Navigator)
19167370 The cysteine residues at positions 156, 206, and 250 play important roles in the enzymatic function and structure of the hAS3MT.
19159958 Results describe the effects of selenium(IV) on the structure and function of recombinant human arsenic (+3 oxidation state) methyltransferase (AS3MT) purified from the cytoplasm of Escherichia coli.
19152805 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976679 intronic single-nucleotide polymorphisms in the AS3MT gene are related to inter-individual variation in arsenic metabolism; The present study is the first to demonstrate genetic heterogeneity in a wide distribution of 5 intronic polymorphisms in AS3MT
18976679 Observational study of genotype prevalence. (HuGE Navigator)
18682255 Observational study of gene-disease association. (HuGE Navigator)
18588996 Our findings indicate that genetic susceptibility to arsenic toxicity in Asian is different from Africans and Caucasians.
18588996 Observational study of genotype prevalence. (HuGE Navigator)
18414634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18334919 Individuals with the AS3MT(287)Thr variant display increased arsenic methylation and thus associated with increased risk for the toxic and genotoxic effects of arsenic exposure
18334919 Observational study of gene-disease association. (HuGE Navigator)
17889916 Observational study of genotype prevalence. (HuGE Navigator)
17889916 mutation frequencies of AS3MT in Asian populations were relatively lower than those of African and Caucasian populations: frequencies of mutation in the Mongolian, Korean, and Japanese populations were 0.040, 0.010, and 0.010, respectively
17850829 Our results indicate that genetic polymorphisms in AS3MT contribute to inter-individual variation in arsenic biotransformation and, therefore, may contribute to inter-individual variations in risk of arsenic toxicity and arsenic carcinogenesis.
17850829 Observational study of gene-disease association. (HuGE Navigator)
17637926 Observational study of gene-disease association. (HuGE Navigator)
17450230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17306849 is strongly associated with the ratio of urinary dimethylarsinic acid to monomethylarsonic acid (D/M) in children (7-11 years) but not in adults (18-79 years)
16407288 inherited variation in AS3MT may contribute to variation in arsenic metabolism
16385451 Observational study of gene-disease association. (HuGE Navigator)
15929903 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15929903 a strong genetic association between polymorphisms of CYT19 and D:M ratio (urinary dimethylarsenic(V) to monomethylarsenic(V))in drinking water exposed Mexican children, not adults.
15808521 Heterologous expression of rat AS3MT in human urothelial cells...confers capacity to methylate inorganic arsenic and alters its cytotoxicity and that of methylated arsenicals.

AA Sequence

MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE      1 - 70
NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG     71 - 140
EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA    141 - 210
LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT    211 - 280
GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA    281 - 350
EESDSMKSRCVPDAAGGCCGTKKSC                                                 351 - 375
//

Text Mined References (76)

PMID Year Title
26411936 2015 [Relationship between Arsenic (+3 Oxidation State) Methyltransferase Genetic Polymorphisms and Methylation Capacity of Inorganic Arsenic].
26366667 2015 Positive selection of AS3MT to arsenic water in Andean populations.
26209557 2015 Linkage Analysis of Urine Arsenic Species Patterns in the Strong Heart Family Study.
25491248 2015 Biological monitoring and the influence of genetic polymorphism of As3MT and GSTs on distribution of urinary arsenic species in occupational exposure workers.
25461954 2015 Family-based association study of the arsenite methyltransferase gene (AS3MT, rs11191454) in Korean children with attention-deficit hyperactivity disorder.
25447140 2014 Mutational analysis of residues in human arsenic (III) methyltransferase (hAS3MT) belonging to 5 Å around S-adenosylmethionine (SAM).
25349987 2014 The functions of crucial cysteine residues in the arsenite methylation catalyzed by recombinant human arsenic (III) methyltransferase.
25156000 2015 Genetic variation in arsenic (+3 oxidation state) methyltransferase (AS3MT), arsenic metabolism and risk of basal cell carcinoma in a European population.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24845704 2015 Influence of the level of arsenic (As) exposure and the presence of T860C polymorphism in human As urinary metabolic profile.
24792412 2014 AS3MT, GSTO, and PNP polymorphisms: impact on arsenic methylation and implications for disease susceptibility.
24621105 2014 Arsenic exposure, AS3MT polymorphism, and neuropsychological functioning among rural dwelling adults and elders: a cross-sectional study.
24536095 2013 Arsenic metabolism efficiency has a causal role in arsenic toxicity: Mendelian randomization and gene-environment interaction.
24361376 2014 Micronucleus frequency in copper-mine workers exposed to arsenic is modulated by the AS3MT Met287Thr polymorphism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239724 2014 Urinary arsenic metabolism in a Western Chinese population exposed to high-dose inorganic arsenic in drinking water: influence of ethnicity and genetic polymorphisms.
24154821 2014 Differential methylation of the arsenic (III) methyltransferase promoter according to arsenic exposure.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23742935 2013 Functional evaluation of Asp76, 84, 102 and 150 in human arsenic(III) methyltransferase (hAS3MT) interacting with S-adenosylmethionine.
23665909 2013 N-6-adenine-specific DNA methyltransferase 1 (N6AMT1) polymorphisms and arsenic methylation in Andean women.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23341986 2013 Efficient arsenic metabolism--the AS3MT haplotype is associated with DNA methylation and expression of multiple genes around AS3MT.
23093101 2013 Environmental exposure to arsenic, AS3MT polymorphism and prevalence of diabetes in Mexico.
23070617 2013 Possible positive selection for an arsenic-protective haplotype in humans.
22955273 2012 Rapid equilibrium kinetic analysis of arsenite methylation catalyzed by recombinant human arsenic (+3 oxidation state) methyltransferase (hAS3MT).
22747749 2012 Genetic variation in glutathione S-transferase omega-1, arsenic methyltransferase and methylene-tetrahydrofolate reductase, arsenic exposure and bladder cancer: a case-control study.
22712827 2012 Structure of an As(III) S-adenosylmethionine methyltransferase: insights into the mechanism of arsenic biotransformation.
22547080 2012 Pregnancy and the methyltransferase genotype independently influence the arsenic methylation phenotype.
22383894 2012 Genome-wide association study identifies chromosome 10q24.32 variants associated with arsenic metabolism and toxicity phenotypes in Bangladesh.
22341486 2012 Low-level arsenic exposure, AS3MT gene polymorphism and cardiovascular diseases in rural Texas counties.
22339537 2012 GSTO and AS3MT genetic polymorphisms and differences in urinary arsenic concentrations among residents in Bangladesh.
22005461 2011 Alternative splicing variants of human arsenic (+3 oxidation state) methyltransferase.
21731446 2011 Individual variations in inorganic arsenic metabolism associated with AS3MT genetic polymorphisms.
21537954 2011 Analysis of arsenic metabolites in HepG2 and AS3MT-transfected cells.
21269460 2011 Initial characterization of the human central proteome.
21247820 2011 Polymorphisms in arsenic(+III oxidation state) methyltransferase (AS3MT) predict gene expression of AS3MT as well as arsenic metabolism.
20971157 2011 Functional and structural evaluation of cysteine residues in the human arsenic (+3 oxidation state) methyltransferase (hAS3MT).
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20621156 2010 New insights into the mechanism of arsenite methylation with the recombinant human arsenic (+3) methyltransferase (hAS3MT).
20571777 2011 Genetic variants associated with arsenic metabolism within human arsenic (+3 oxidation state) methyltransferase show wide variation across multiple populations.
20547570 2010 Arsenic induces DNA damage in environmentally exposed Mexican children and adults. Influence of GSTO1 and AS3MT polymorphisms.
20532380 2010 Genetic polymorphism of As3MT and delayed urinary DMA excretion after organic arsenic intake from oyster ingestion.
20129672 2010 Transition metal ions and selenite modulate the methylation of arsenite by the recombinant human arsenic (+3 oxidation state) methyltransferase (hAS3MT).
20014157 2010 Genetic association between intronic variants in AS3MT and arsenic methylation efficiency is focused on a large linkage disequilibrium cluster in chromosome 10.
19932709 2010 Global analysis of genetic variation in human arsenic (+3 oxidation state) methyltransferase (AS3MT).
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19538983 2009 Association of AS3MT polymorphisms and the risk of premalignant arsenic skin lesions.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19411561 2009 Expression of AS3MT alters transcriptional profiles in human urothelial cells exposed to arsenite.
19371612 2009 Genetic polymorphisms in AS3MT and arsenic metabolism in residents of the Red River Delta, Vietnam.
19167370 2009 Structure-function roles of four cysteine residues in the human arsenic (+3 oxidation state) methyltransferase (hAS3MT) by site-directed mutagenesis.
19159958 2009 Effects of selenium on the structure and function of recombinant human S-adenosyl-L-methionine dependent arsenic (+3 oxidation state) methyltransferase in E. coli.
19152805 2009 Synergistic effect of polymorphisms of paraoxonase gene cluster and arsenic exposure on electrocardiogram abnormality.
18976679 2009 Ethnic differences in five intronic polymorphisms associated with arsenic metabolism within human arsenic (+3 oxidation state) methyltransferase (AS3MT) gene.
18682255 2009 Arsenic metabolism is influenced by polymorphisms in genes involved in one-carbon metabolism and reduction reactions.
18588996 2008 Asian specific low mutation frequencies of the M287T polymorphism in the human arsenic (+3 oxidation state) methyltransferase (AS3MT) gene.
18414634 2008 Genetic variants associated with arsenic susceptibility: study of purine nucleoside phosphorylase, arsenic (+3) methyltransferase, and glutathione S-transferase omega genes.
18334919 2008 High arsenic metabolic efficiency in AS3MT287Thr allele carriers.
17889916 2007 Population differences in the human arsenic (+3 oxidation state) methyltransferase (AS3MT) gene polymorphism detected by using genotyping method.
17850829 2008 Role of the Met(287)Thr polymorphism in the AS3MT gene on the metabolic arsenic profile.
17637926 2007 Metabolism of low-dose inorganic arsenic in a central European population: influence of sex and genetic polymorphisms.
17450230 2007 Genetic polymorphisms influencing arsenic metabolism: evidence from Argentina.
17306849 2007 Developmental and genetic modulation of arsenic biotransformation: a gene by environment interaction?
16407288 2006 Human arsenic methyltransferase (AS3MT) pharmacogenetics: gene resequencing and functional genomics studies.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15929903 2005 Developmentally restricted genetic determinants of human arsenic metabolism: association between urinary methylated arsenic and CYT19 polymorphisms in children.
15808521 2005 Arsenic (+3 oxidation state) methyltransferase and the inorganic arsenic methylation phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790780 2002 A novel S-adenosyl-L-methionine:arsenic(III) methyltransferase from rat liver cytosol.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.