Property Summary

NCBI Gene PubMed Count 34
PubMed Score 191.39
PubTator Score 152.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.100 2.4e-04
non-small cell lung cancer 1.838 2.8e-10

Gene RIF (28)

AA Sequence

MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRT      1 - 70
ARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHR     71 - 140
SDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDR    141 - 210
LSATACGCLG                                                                211 - 220
//

Text Mined References (34)

PMID Year Title