Property Summary

NCBI Gene PubMed Count 33
PubMed Score 182.62
PubTator Score 152.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.838 2.8e-10
cystic fibrosis 1.100 2.4e-04

Gene RIF (25)

PMID Text
26270588 mRNA expression of Artemin (Artn) in the tongue mucosa of patients with burning mouth syndrome was significantly higher than that of control subjects.
25243385 Artemin expression promotes invasiveness and neurotrophic function of pancreatic adenocarcinoma cells in vivo and in vitro
24994477 This is the first report of increased levels of a neurotrophic factor and of a glial cell line-derived neurotrophic factor family member in GAD patients.
24737320 conclude that ARTN is one mediator of acquired resistance to trastuzumab in HER2-positive mammary carcinoma cells
23351331 The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma.
23185544 ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signaling.
23095743 ARTN promotion of the cancer stem cell-like cell phenotype was mediated by TWIST1 regulation of BCL-2 expression.
22901124 High artemin promotes motility and invasiveness of pancreatic cancer.
22770266 artemin lowers the threshold of temperature-dependent itch sensation.
22060274 ARTN and TWIST1 synergize to produce a worse outcome in ER-MC and combined inhibition of ARTN and phosphatidylinositol 3-kinase/protein kinase B (PI3K/AKT) may therefore provide a novel therapeutic strategy in this subtype of mammary carcinoma.
22008109 Studies indicate that artemin was highly expressed in squamous cell carcinoma lung cancer.
21907286 Presenting an efficient method for the recombinant bacterial production of large quantities of highly pure, biologically active ARTN for in vitro and in vivo studies.
21453483 These results reveal that ARTN, a known tumor metastasis-related gene, is a direct target of miR-223.
20530713 ARTN increased BCL2 expression by transcriptional upregulation, and inhibition of BCL2 abrogated the oncogenic properties of ARTN in non-small cell lung carcinoma cells.
20395845 Artemin is a key player in the generation of pancreatic neuropathy in pancreatic neoplasms.
20305694 Forced expression of ARTN in ER-positive human mammary carcinoma cells increased ER transcriptional activity, promoted estrogen-independent growth and produced resistance to tamoxifen.
20118197 expression in endometrial carcinoma significantly associated with higher tumor grade and invasiveness
19363524 Forced expression of artemin in mammary carcinoma cells results in increased anchorage-independent growth, increased colony formation in soft agar and in Matrigel, and promotes a scattered cell phenotype with enhanced migration and invasion.
19304517 Artemin and GFRalpha3 expressions may play an important role in perineural invasion of pancreatic carcinoma.
18970938 No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients.
18970938 Observational study of gene-disease association. (HuGE Navigator)
18313696 Data show that reduced expression levels of ARTN mRNAs are found in patients with major depressive disorder in a current depressive state, but not in a remissive state.
16765900 1.92 A crystal structure of the complex formed between ARTN and its receptor GFRalpha3 was reported.
16734417 This study suggests that ART binds heparan sulfate proteoglycans (HSPG) and identifies residues that may be involved in HSPG binding.
15829225 The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons.

AA Sequence

MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRT      1 - 70
ARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHR     71 - 140
SDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDR    141 - 210
LSATACGCLG                                                                211 - 220
//

Text Mined References (33)

PMID Year Title
26908049 2016 Investigating the Role of Artemin Glycosylation.
26675549 2016 Artemin is hypoxia responsive and promotes oncogenicity and increased tumor initiating capacity in hepatocellular carcinoma.
26270588 2015 Involvement of peripheral artemin signaling in tongue pain: possible mechanism in burning mouth syndrome.
25243385 2015 Neurotrophic Factor Artemin Promotes Invasiveness and Neurotrophic Function of Pancreatic Adenocarcinoma In Vivo and In Vitro.
24994477 2014 BDNF and Artemin are increased in drug-naïve non-depressed GAD patients: preliminary data.
24737320 2014 Artemin, a member of the glial cell line-derived neurotrophic factor family of ligands, is HER2-regulated and mediates acquired trastuzumab resistance by promoting cancer stem cell-like behavior in mammary carcinoma cells.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
23185544 2012 ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signalling.
23095743 2012 Artemin stimulates radio- and chemo-resistance by promoting TWIST1-BCL-2-dependent cancer stem cell-like behavior in mammary carcinoma cells.
22901124 2012 Neurotrophic artemin promotes motility and invasiveness of MIA PaCa-2 pancreatic cancer cells.
22770266 2012 Artemin causes hypersensitivity to warm sensation, mimicking warmth-provoked pruritus in atopic dermatitis.
22060274 2011 ARTEMIN synergizes with TWIST1 to promote metastasis and poor survival outcome in patients with ER negative mammary carcinoma.
22008109 2011 [Research advances of artemin].
21907286 2012 Recombinant expression, purification and dimerization of the neurotrophic growth factor Artemin for in vitro and in vivo use.
21453483 2011 miR-223 regulates migration and invasion by targeting Artemin in human esophageal carcinoma.
20530713 2010 Artemin-stimulated progression of human non-small cell lung carcinoma is mediated by BCL2.
20395845 2010 Nerve growth factor and artemin are paracrine mediators of pancreatic neuropathy in pancreatic adenocarcinoma.
20305694 2010 Artemin is estrogen regulated and mediates antiestrogen resistance in mammary carcinoma.
20118197 2010 Artemin stimulates oncogenicity and invasiveness of human endometrial carcinoma cells.
19363524 2009 Artemin is oncogenic for human mammary carcinoma cells.
19304517 2009 [Artemin and GFRalpha3 expressions and their relevance to perineural invasiveness and metastasis of pancreatic carcinoma].
18970938 2008 Polymorphisms in the genes encoding the 4 RET ligands, GDNF, NTN, ARTN, PSPN, and susceptibility to Hirschsprung disease.
18313696 2008 Altered expression of neurotrophic factors in patients with major depression.
16765900 2006 Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors.
16734417 2006 Artemin crystal structure reveals insights into heparan sulfate binding.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15829225 2005 Neurturin, persephin, and artemin in the human pre- and full-term newborn and adult hippocampus and fascia dentata.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673327 2000 In vivo protection of nigral dopamine neurons by lentiviral gene transfer of the novel GDNF-family member neublastin/artemin.
10583383 1999 Enovin, a member of the glial cell-line-derived neurotrophic factor (GDNF) family with growth promoting activity on neuronal cells. Existence and tissue-specific expression of different splice variants.
9883723 1998 Artemin, a novel member of the GDNF ligand family, supports peripheral and central neurons and signals through the GFRalpha3-RET receptor complex.
9448325 1998 Expression and regulation of GFRalpha3, a glial cell line-derived neurotrophic factor family receptor.