Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.46
PubTator Score 26.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25988428 Characterization of two novel DO*B alleles highlights the value of testing selected ethnic groups in understanding DO allele diversity.
23421541 The production, serologic evaluation, and epitope mapping of ten murine monoclonal Dombrock antibodies.
20932078 The Dombrock blood group system
20431033 Observational study of genetic testing. (HuGE Navigator)
19413734 Dombrock genotyping in a native Congolese cohort reveals two novel alleles.
18510579 Observational study of genetic testing. (HuGE Navigator)
16140404 Expression of ART4 was analyzed in mononuclear leukocytes.
15847654 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCS      1 - 70
KQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAM     71 - 140
ASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLST    141 - 210
SLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGNWLQLRSTGNLSTYNC    211 - 280
QLLKASSKKCIPDPIAIASLSFLTSVIIFSKSRV                                        281 - 314
//

Text Mined References (22)

PMID Year Title
25988428 2015 Sequencing of the ART4 gene in sub-Saharan cohorts reveals ethnic differences and two new DO alleles: DO*B-Ile5Thr and DO*B-Trp266Arg.
23421541 2012 The production, serologic evaluation, and epitope mapping of ten murine monoclonal Dombrock antibodies.
20932078 2010 The Dombrock blood group system: a review.
20431033 2010 Single PCR multiplex SNaPshot reaction for detection of eleven blood group nucleotide polymorphisms: optimization, validation, and one year of routine clinical use.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19413734 2009 Dombrock genotyping in a native Congolese cohort reveals two novel alleles.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
16140404 2005 Analysis of mono-ADP-ribosyltransferase 4 gene expression in human monocytes: splicing pattern and potential regulatory elements.
16040347 2005 Analysis of the 3' UTR of the ART3 and ART4 gene by 3' inverse RACE-PCR.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12519438 2003 The Dombrock blood group system: a review.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070318 2002 The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse.
12028057 2002 Two new molecular bases for the Dombrock null phenotype.
11896313 2002 Insights into the Holley- and Joseph- phenotypes.
11520417 2001 Polymerase chain reaction with sequence-specific primers-based genotyping of the human Dombrock blood group DO1 and DO2 alleles and the DO gene frequencies in Chinese blood donors.
11001920 2000 Identification of the dombrock blood group glycoprotein as a polymorphic member of the ADP-ribosyltransferase gene family.
10971215 2000 Confirmation of the assignment of the Dombrock blood group locus (DO) to chromosome 12p: narrowing the boundaries to 12p12.3-p13.2.
9119374 1997 Two novel human members of an emerging mammalian gene family related to mono-ADP-ribosylating bacterial toxins.
8882867 1996 Dombrock blood group (DO): assignment to chromosome 12p.
6034522 1967 Genetics of the Dombrock blood group system.