1. Home
  2. Targets
  3. transferase
  4. glycosyltransferase
  5. Ecto-ADP-ribosyltransferase 3

Tbio Ecto-ADP-ribosyltransferase 3

This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.51
PubTator Score 39.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Esophageal candidiasis 3 3.755 1.9
Azoospermia 89 3.551 1.8

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.400 7.9e-03
ependymoma -2.100 4.9e-02
oligodendroglioma -2.000 2.0e-02
medulloblastoma -2.300 5.7e-09
atypical teratoid / rhabdoid tumor -2.200 7.9e-08
glioblastoma -1.600 1.6e-04
primitive neuroectodermal tumor -1.600 2.4e-02
Duchenne muscular dystrophy -1.513 9.4e-08
Becker muscular dystrophy -1.150 5.7e-04
limb girdle muscular dystrophy 2A -1.277 2.2e-05
active Crohn's disease 3.029 3.5e-03
active ulcerative colitis 1.790 9.9e-03
pediatric high grade glioma -1.300 8.0e-04
subependymal giant cell astrocytoma -1.006 4.6e-02
Pick disease -1.100 8.3e-04
pituitary cancer -1.300 1.1e-02
facioscapulohumeral dystrophy 1.800 4.7e-02

Synonym

Accession Q13508 Q53XW3 Q6FHT7 Q8WVJ7 Q93069 Q96HL1
Symbols ARTC3

Gene

ART3

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (2)

 GO Component (3)

 GO Process (1)

 Compartment GO Term (22)

See all...

 HCA RNA Cell Line (22)

See all...

Pathway (4)

Protein-protein Interaction (9)

GPLD1   ATP12A   PAM   NAGLU   ARSK   HSPA12A   CBWD3   POGLUT1   ITGA8  

Gene RIF (8)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18266473 genome-wide gene expression analyses were used to identify genes involved in the pathogenesis of non-obstructive azoospermia, and ART3 was subsequently identified as a susceptibility gene
18266473 Observational study of gene-disease association. (HuGE Navigator)
16934346 ART3 expression appears to be governed by a combination of differential splicing and tissue-preferential use of two alternative promoters.
16625277 ART3 protein is expressed in testes in particular on spermatocytes, indicating that ART3 exerts a specific function only required at a particular stage of spermatogenesis.

AA Sequence 

MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVW      1 - 70
ENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHF     71 - 140
YLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVD    141 - 210
IENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVY    211 - 280
NPGEKNQKLEDHSEKNWKLEDHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPV    281 - 350
PVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVAL                                   351 - 389
//

Text Mined References (20)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18266473 2008 Genome-wide expression of azoospermia testes demonstrates a specific profile and implicates ART3 in genetic susceptibility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16934346 2006 Genomic organization and expression of the human mono-ADP-ribosyltransferase ART3 gene.
16625277 2006 Expression of toxin-related human mono-ADP-ribosyltransferase 3 in human testes.
16040347 2005 Analysis of the 3' UTR of the ART3 and ART4 gene by 3' inverse RACE-PCR.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070318 2002 The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse.
11879200 2002 Mono-ADP-ribosyltransferases in human monocytes: regulation by lipopolysaccharide.
10460751 1999 Selective expression of RT6 superfamily in human bronchial epithelial cells.
9119374 1997 Two novel human members of an emerging mammalian gene family related to mono-ADP-ribosylating bacterial toxins.
8605984 1996 Human testis specifically expresses a homologue of the rodent T lymphocytes RT6 mRNA.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.