Property Summary

NCBI Gene PubMed Count 13
PubMed Score 115.03
PubTator Score 72.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.7e-07
psoriasis 6514 5.2e-03
Disease Target Count Z-score Confidence
Arts syndrome 26 5.518 2.8
Lymphopenia 66 3.797 1.9
Cryptococcal meningitis 6 3.153 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.506 1.7e-07
psoriasis -1.400 5.2e-03

 GO Process (1)

Gene RIF (7)

AA Sequence

MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQ      1 - 70
ANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYTANSPLHKEFNAAVREAGR     71 - 140
SRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRGVHGLRFRPAGPRATVRLGGFASASLKHVAA    141 - 210
QQFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYI    211 - 280
KDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAFPDGPGLL                           281 - 327
//

Text Mined References (16)

PMID Year Title